KEGG   Methanobacterium congolense: MCBB_1990Help
Entry
MCBB_1990         CDS       T04503                                 

Definition
(GenBank) putative protein MJ0841
Organism
mcub  Methanobacterium congolense
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Radical_SAM
Motif
Other DBs
NCBI-ProteinID: SCG86538
UniProt: A0A1D3L4R8
Position
I:2067334..2068596
Genome map
AA seq 420 aa AA seqDB search
MQIIADVGGIPGKDCRGFCKYCYFRKVKGNDPFGCRYCSPGRVGCESCTTGVRETKNEFI
PPFMVLGSVQNSIMMGNYHDNDLKVNISGGGDVSCYPQLLELAAGLNQWKLPIHLGYTSG
KGIDDSKVAEDLISLGVNEVTFTVFSTDPKLRKEWVLDQKPEESMKALEIFCQNSEVHAA
SVIVPGVNDGEKLFETCSKLEEWGAKAFILMRFANYRNQGLILGNEPIIEGVESHSLDEF
DELVKTVNKEFNLRVTGTPVCDPENDTPFAISKDKNREYLDILSEVTSEATILTSKVSAP
FIEKIIKNIGAEDLVNVVAADQDIGCLITHEDLEKIDLGDLTETVLLPGRAYVHNKRAQE
ILSRDGVDRIVTRGPEKLSVDGEMSGTLTREEVLKKELIAFEDLIEAINFFGVRKKPIKR
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atgcagattatagcagatgtaggcggaatacctggtaaagactgcagagggttctgtaaa
tactgttacttcagaaaagtaaaaggaaatgacccttttggatgtaggtactgctcacca
ggaagggttgggtgtgaaagctgcacaactggagtcagagaaacaaaaaacgaatttata
cccccatttatggttttaggctcagttcaaaattccattatgatgggaaactaccatgat
aatgacctgaaggtaaatataagtggaggaggagatgtaagctgttaccctcagttgtta
gaacttgcagcaggattgaatcaatggaaactcccaatacacttgggttacaccagtggg
aaaggtatagatgattcaaaagttgcagaggatttaatttccctcggtgttaatgaggtt
acctttactgttttctcaacggatcctaaacttcggaaggagtgggtgctggaccagaaa
cctgaagagtccatgaaagccctggagatattctgccagaacagtgaggttcatgcagca
tctgtcatagttccaggtgttaacgacggtgaaaaactctttgaaacctgcagcaaactg
gaagaatggggtgcaaaggcattcatacttatgaggtttgcaaattaccgtaatcaggga
ctcatacttggaaatgaacccataattgaaggtgtggaatcccacagtttagatgagttt
gatgagctcgttaaaaccgttaacaaggagttcaacctcagagttacaggcactccagta
tgtgaccctgaaaatgacacaccatttgcaatttcaaaggataaaaacagggaatatctt
gatatattatctgaagtcacatctgaagccaccattctcacaagtaaggtttcagcacct
ttcattgaaaagataattaagaacatcggagctgaagaccttgtgaacgttgttgcagca
gaccaggacataggctgtctcataacccacgaagatcttgagaagatcgacctgggtgat
cttactgaaactgtactgctccccggaagggcatacgttcataataaaagggcccaggag
atattgagccgtgatggtgtggacagaatcgttacaaggggtcctgaaaaattatcagtt
gacggagagatgagtggaacccttacacgtgaagaagtccttaaaaaagagcttatagca
tttgaagatttgattgaagctataaacttctttggagttagaaaaaaacctattaaaagg
taa

DBGET integrated database retrieval system