KEGG   Methanobacterium congolense: MCBB_2112Help
Entry
MCBB_2112         CDS       T04503                                 

Definition
(GenBank) putative protein MJ1309
  KO
K14115  energy-converting hydrogenase B subunit F
Organism
mcub  Methanobacterium congolense
Brite
KEGG Orthology (KO) [BR:mcub00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99982 Energy metabolism
    MCBB_2112
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Proton_antipo_M NADHdeh_related
Motif
Other DBs
NCBI-ProteinID: SCG86655
UniProt: A0A1D3L537
Position
I:complement(2182385..2183887)
Genome map
AA seq 500 aa AA seqDB search
MDYMNSLIPLMVIIPITCALFLNLLHERDRTIKVLSVIIALALPIVPLFANYGTHYFGGY
APLIQNGAIATGLPAFITGSALNVFHPAITYVFGSAQKLFIFIVGIVALFSIFLSLYEVK
RPSGMYGYLLFMLAASITALILTDDIFNLFVFFEIAALAQVGIILVSKVKGSYETALKYM
ILGSIASPMMLLGIAFLLGVTGNVNITDIVYAIKHGLVDPKSPVLLMACGLITFGWLYGS
GLPPFHSIKSAVYSKALPNGAALLQAFSVVMFVALGVIILRIFGYLPFSKVFIIGISLLA
MVLGITMALNQTDFKRIIGYLAVGELGYIGIGLGLGTAMGVTAGLFQAVNELVVTAFLFI
GFGTVLYKTRESDVRKLGGMMVQSPKTAFLVMIAGFAMAGVPPLNVFQSKLMLCQAAVDA
GLPELGIIMIVLSIVTFMTFMRAYYAIYLRPKPDDLEIKNEKIPRVTLLAMVVFLIICIV
FGLFPGLATNSLQGLAVNIA
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atggattatatgaattcattaatcccgttgatggttataataccaatcacttgtgccctg
ttcctgaacctgctgcatgaaagggacagaaccatcaaggtactgtcagtgatcattgca
ctggcactgccaattgtcccactttttgcaaactatggaacccattacttcggtggatac
gcaccgctcatccagaatggggccatagcaacagggttacctgcattcataacaggttca
gcactcaacgtgttccaccctgcaataacctacgtatttggaagtgcacagaagctcttc
atattcatagtgggaattgtggcattgttctcaatattcctatctctttacgaggttaaa
aggccttctggaatgtatggataccttttattcatgcttgcagcttcaataactgctttg
atactcacagatgacatattcaaccttttcgttttctttgagatagcagcactggcacag
gttggtataatccttgtttcaaaggttaagggcagctatgaaacagccctcaagtacatg
atacttggaagtatagcttctccaatgatgctccttggaatagcattcctccttggagtt
acaggaaacgttaacatcacagatattgtttatgcgattaaacatggactggtggatccc
aagagcccagtacttctaatggcatgcggccttataacctttggatggctctacggttca
ggacttccaccgttccactcaataaagtcagcggtttacagcaaagcactcccaaatgga
gctgcattgcttcaggcattttcggttgtgatgttcgtagcccttggagtcataatatta
aggatatttggttacctcccattctcaaaggtcttcataataggaatatccctccttgca
atggttctgggtataaccatggccctgaaccagaccgatttcaaacgtatcataggttac
cttgcagtgggtgaacttggatacattggaataggacttggacttggaactgcaatggga
gtaacagcaggactcttccaggctgttaacgaacttgtagtaactgcattcctattcata
ggtttcggtaccgtactctacaaaaccagggaaagtgatgtgagaaaactgggaggcatg
atggtacagtcaccaaaaacagcctttttggttatgatagcaggctttgcaatggcagga
gtccctccattgaacgttttccagagtaaattaatgctctgtcaggctgctgtggatgca
ggactacccgagctcggtataataatgatagtcctgagtatcgtgaccttcatgaccttc
atgagggcatactacgccatatacctgagaccaaaaccagatgaccttgagatcaaaaac
gaaaaaataccaagggtaacactccttgcaatggtggtgttcctgataatatgcatagta
tttggtctgttcccaggtcttgcaaccaattctctgcagggacttgcggtgaacattgca
tag

DBGET integrated database retrieval system