KEGG   Mycobacterium canettii CIPT 140070008: BN43_10573Help
Entry
BN43_10573        CDS       T02420                                 

Gene name
hemL
Definition
(GenBank) Putative glutamate-1-semialdehyde 2,1-aminomutase HemL(GSA) (glutamate-1-semialdehyde aminotransferase) (GSA-AT)
  KO
K01845  glutamate-1-semialdehyde 2,1-aminomutase [EC:5.4.3.8]
Organism
mcv  Mycobacterium canettii CIPT 140070008
Pathway
mcv00860  Porphyrin and chlorophyll metabolism
mcv01100  Metabolic pathways
mcv01110  Biosynthesis of secondary metabolites
mcv01120  Microbial metabolism in diverse environments
Module
mcv_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:mcv00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    BN43_10573 (hemL)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:mcv01007]
    BN43_10573 (hemL)
Enzymes [BR:mcv01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.8  glutamate-1-semialdehyde 2,1-aminomutase
     BN43_10573 (hemL)
Amino acid related enzymes [BR:mcv01007]
 Aminotransferase (transaminase)
  Class III
   BN43_10573 (hemL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3
Motif
Other DBs
NCBI-ProteinID: CCK54471
Position
615636..617024
Genome map
AA seq 462 aa AA seqDB search
MGSTEQATSRVRGAARTSAQLFEAACSVIPGGVNSPVRAFTAVGGTPRFITEAHGCWLID
ADGNRYVDLVCSWGPMILGHAHPAVVEAVAKAAARGLSFGAPTPAETQLAGEIIGRVAPV
ERIRLVNSGTEATMSAVRLARGFTGRAKIVKFSGCYHGHVDALLADAGSGVATLGLCDDP
QRPASPRSRSSRGLPSSLGVTGAAAADTIVLPYNDIDAVQQTFARFGEQIAAVITEASPG
NMGVVPPVPGFNAALRAITAEYGALLILDEVMTGFRVSRSGWFGIDPVPADLFTFGKVMS
GGMPAAAFGGRAEVMQRLAPLGPVYQAGTLSGNPVAVAAGLATLRAADDAVYTALDANAD
RLAGLLSEALTDAVVPHQISRAGNMLSVFFGETPVTDFASARASQTWRYPAFFHAMLDAG
VYPPCSAFEAWFVSAALDDAAFGRIADALPAAARAAAQERPA
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atgggcagcacggaacaggccacctcgcgggtaaggggggccgcgcgcacatcggcgcag
ctgttcgaggccgcatgcagcgtcatacccggcggagtgaactccccggtgcgggcgttc
acggcggtgggcggcaccccgcgcttcattaccgaagcccacggctgctggttgattgac
gccgacggcaaccgctacgtagacctggtctgctcatggggcccgatgatcctcggtcac
gcgcatccggccgtcgtcgaggcagtggccaaggccgcagcccgcggcctgtccttcggg
gccccgactcccgccgaaacccaactagccggcgagatcatcggccgggtagctcccgtc
gagcggatacggctggtgaactccggcaccgaggccactatgagcgccgtgcggctggcc
cgcggattcaccggccgggccaagatcgtcaagttctccggctgctaccacggacacgtc
gacgcattgctcgccgacgcgggttcgggagtggccaccctgggcttatgtgacgacccc
cagcgcccggcttcgccgcgctcgcgatcgtcacggggcctgccgtcctcgctcggggtc
actggcgccgcggcagccgacacgatcgtgttgccctacaacgacatcgatgccgtacag
cagaccttcgcccggttcggcgagcagatcgccgcggtgatcaccgaggccagccccggc
aatatgggcgtcgttccgccagtgcccggctttaacgcggcgctgcgcgcgatcaccgcc
gagtacggcgcactgctgatcctcgacgaggtgatgaccgggtttcgggtcagcagaagt
ggttggttcggaatcgatccggtgcccgctgacctgttcaccttcggcaaggtgatgagc
ggcgggatgcccgccgccgcgttcggcgggcgcgccgaggtgatgcagcggctggcgccg
ctggggccggtgtatcaggccggcacgttgtcgggtaacccggtggcggttgccgccggg
ctggcaacgctgcgggccgccgacgacgcggtctacaccgcattggacgccaacgctgac
cgcctggccggcctgctctccgaggcactgacggatgccgttgtgccacaccagatttcg
cgggcaggcaatatgctcagtgtgttcttcggcgaaacaccggtgaccgacttcgcgtcc
gcgcgggccagccagacctggcgttatccagcgttctttcatgccatgctggacgccggt
gtctacccgccgtgcagtgccttcgaggcatggttcgtctcggccgctttggacgacgcg
gcgttcggccggatcgccgacgcgctgcccgccgcggcccgagcagcggcccaggaaagg
cccgcctga

DBGET integrated database retrieval system