KEGG   Mycobacterium canettii CIPT 140070008: BN43_20310Help
Entry
BN43_20310        CDS       T02420                                 

Gene name
fadA
Definition
(GenBank) Putative acyl-CoA thiolase FadA
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
mcv  Mycobacterium canettii CIPT 140070008
Pathway
mcv00071  Fatty acid degradation
mcv00072  Synthesis and degradation of ketone bodies
mcv00280  Valine, leucine and isoleucine degradation
mcv00310  Lysine degradation
mcv00362  Benzoate degradation
mcv00380  Tryptophan metabolism
mcv00620  Pyruvate metabolism
mcv00630  Glyoxylate and dicarboxylate metabolism
mcv00640  Propanoate metabolism
mcv00650  Butanoate metabolism
mcv00900  Terpenoid backbone biosynthesis
mcv01100  Metabolic pathways
mcv01110  Biosynthesis of secondary metabolites
mcv01120  Microbial metabolism in diverse environments
mcv01130  Biosynthesis of antibiotics
mcv01200  Carbon metabolism
mcv01212  Fatty acid metabolism
mcv02020  Two-component system
Brite
KEGG Orthology (KO) [BR:mcv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BN43_20310 (fadA)
   00630 Glyoxylate and dicarboxylate metabolism
    BN43_20310 (fadA)
   00640 Propanoate metabolism
    BN43_20310 (fadA)
   00650 Butanoate metabolism
    BN43_20310 (fadA)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BN43_20310 (fadA)
   00072 Synthesis and degradation of ketone bodies
    BN43_20310 (fadA)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BN43_20310 (fadA)
   00310 Lysine degradation
    BN43_20310 (fadA)
   00380 Tryptophan metabolism
    BN43_20310 (fadA)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BN43_20310 (fadA)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BN43_20310 (fadA)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BN43_20310 (fadA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mcv04147]
    BN43_20310 (fadA)
Enzymes [BR:mcv01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BN43_20310 (fadA)
Exosome [BR:mcv04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BN43_20310 (fadA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: CCK54803
Position
948707..949918
Genome map
AA seq 403 aa AA seqDB search
MSEEAFIYEAIRTPRGKQKNGSLHEVKPLSLVVGLIDELRKRHPDLDENLISDVILGCVS
PVGDQGGDIARAAVLASGMPVTSGGVQLNRFCASGLEAVNTAAQKVRSGWDDLVLAGGVE
SMSRVPMGSDGGAMGLDPATNYDVMFVPQGIGADLIATIEGFSREDVDAYALRSQQKAAE
AWSGGYFAKSVVPVRDQNGLLILDHDEHMRPDTTKEGLAKLKPAFEGLAALGGFDDVALQ
KYHWVEKINHVHTGGNSSGIVDGAALVMIGSEAAGKSQGLTPRARIVATATSGADPVIML
TGPTPATRKVLDRAGLTVDDIDLFELNEAFASVVLKFQKDLNIPDEKLNVNGGAIAMGHP
LGATGAMILGTMVDELERRNARRALITLCIGGGMGVATIIERV
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgtccgaagaagccttcatctacgaggccatccgcaccccgcgcggcaaacaaaagaac
ggatcgttgcacgaagtcaagccattgagcctggtcgtcggcctgatcgacgagctgcgc
aagcgccatcccgacctcgacgagaacctgatcagtgacgtcatcttgggctgcgtctca
ccggtgggcgaccagggcggcgacatcgcccgcgccgcggtgctggcatcgggcatgccg
gtcacctccggcggtgtgcagctcaaccggttctgcgcgtccggcctggaggccgtcaac
accgccgcgcagaaggtgcgctccggctgggacgacctggtgctggccggcggtgtggag
tcgatgagccgggtgccgatgggctccgacggcggcgcgatgggcctggacccggcgacc
aactacgacgtcatgttcgtcccgcagggcatcggcgccgacctgatcgccaccatcgag
ggtttctcccgcgaggatgtcgacgcctacgcgctgcgcagccagcaaaaggccgccgag
gcgtggtcgggcggctacttcgccaagtcggtggtgccggtgcgcgaccagaacggtctg
ttgatcctcgaccacgacgagcacatgcgtcccgacaccaccaaggagggtctggccaag
ctgaagccggccttcgaaggcctggccgcgctgggcggtttcgacgacgtcgcgctgcag
aagtaccactgggtcgagaagatcaaccacgtgcacaccggcgggaacagctccgggatc
gtcgacggcgcggcactggtgatgatcggttccgaggccgccggcaagtcgcagggcctg
actccgcgggcccgtatcgtcgccaccgccaccagcggcgccgacccggtgatcatgctg
accggcccaaccccggccacccgcaaggtgctcgaccgcgccgggctgaccgtcgacgac
atcgacctgttcgagctcaacgaggcgttcgcgtcggtggtgctgaagttccagaaagac
ctcaacattcccgacgagaagctcaacgtcaacggcggcgccatcgcgatgggccacccg
ctgggtgccaccggcgcgatgatcctgggcaccatggtcgacgaactggagcgccgcaac
gcccgacgtgcgcttatcacgctgtgcatcgggggcggcatgggtgtcgcgacgatcatc
gagagggtttaa

DBGET integrated database retrieval system