KEGG   Mycobacterium canettii CIPT 140070008: BN43_31521Help
Entry
BN43_31521        CDS       T02420                                 

Gene name
pitB
Definition
(GenBank) Putative phosphate-transport permease PitB
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
mcv  Mycobacterium canettii CIPT 140070008
Brite
KEGG Orthology (KO) [BR:mcv00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    BN43_31521 (pitB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: CCK56318
Position
2607648..2609306
Genome map
AA seq 552 aa AA seqDB search
MSGNAKHHRDGHLVASGLQDRAARTPQHEGFLVPDRPWHLSFSLLLAGSFVLFSWWAFDY
AGSGANKVILVLATVVGMFMAFNVGGNDVANSFGTSVGAGTLTMKQALLVAAIFEVSGAV
IAGGDVTETIRSGIVDLSGVSVDPRDFMNIMLSALSAAALWLLFANRMGYPVSTTHSIIG
GIVGAAIALGMVSGQGGAALRMVQWDQIGQIVVSWVLSPVLGGLVSYLLYGVIKRHILLY
NEQAERRLTEIKKERIAHRERHKAAFDRLTEIQQIAYTGALARDAVAANRKDFDPDELES
DYYRELHEIDAKTSSVDAFRALQNWVPLVAAAGSMIIVAMLLFKGFKHMHLGLTTMNNYF
IIAMVGAAVWMATFIFAKTLRGESLSRSTFLMFSWMQVFTASGFAFSHGSNDIANAIGPF
AAILDVLRTGAIEGNAAVPAAAMVTFGVALCAGLWFIGRRVIATVGHNLTTMHPASGFAA
ELSAAGVVMGATVLGLPVSSTHILIGAVLGVGIVNRSTNWGLMKPIVLAWVITLPSAAIL
ASVGLVALRAIF
NT seq 1659 nt NT seq  +upstreamnt  +downstreamnt
atgagcggcaatgccaaacaccacagggatgggcatttggtggctagcggacttcaggat
cgcgcagcgcgcacaccgcaacacgagggcttcctcgtgccggaccgaccatggcacctg
tcgttcagtctgctgctggcgggttctttcgtgctgttctcgtggtgggcattcgactac
gcagggtccggcgcgaacaaggtcatcctggtgctcgccaccgtcgtcggcatgttcatg
gccttcaacgtcggcggcaatgatgtcgccaactcgtttggcaccagcgtcggcgcgggc
acgttgaccatgaaacaggcgcttctggtcgcggcgatcttcgaggtcagcggcgcggtg
atcgccggcggcgacgtcaccgagaccatccgcagcggcatcgttgatctgtccggggtg
tccgtcgacccacgcgacttcatgaacatcatgctgtcggcgctatcggcagccgcgctc
tggctgctgtttgctaaccgtatggggtacccggtgtcgaccacacactcgatcatcggc
ggcatcgtcggcgcggcgatagcgctggggatggtgagcggccagggcggtgccgcactc
aggatggtccagtgggatcaaatcggccagatcgtggtgtcctgggtgctgtcgccggtg
ttgggcggcttggtgtcgtacctgctctacggcgtcatcaaacggcacatcctgctgtac
aacgaacaggccgaacgacggctaacagaaattaagaaagagcgcatcgcacaccgcgag
cgccacaaggcggcgttcgaccggctcaccgagatccagcagatcgcctataccggcgcc
ctggcgcgcgacgccgtcgcggcaaaccgcaaggactttgatcccgacgaactggaatcc
gattactaccgcgagctacacgaaatcgacgccaagacatcgtcggtcgacgcgttccgg
gccctgcagaactgggttccgctggtcgccgccgccggatccatgatcattgtcgcgatg
ctgctgttcaaggggttcaagcacatgcacttgggcctcaccacgatgaataactacttc
atcatcgcgatggtcggtgcagcggtgtggatggccacctttattttcgccaagacactt
cggggcgaatcactttcacggtcaacgtttttgatgttcagctggatgcaggtctttacg
gcctcgggcttcgccttcagccacggcagcaatgacattgccaacgccatcgggccgttc
gcggcaatcctggatgtgctgcgcacgggcgccattgaaggcaacgcagcggtgcctgcc
gcggccatggtcacgttcggcgtcgcgttgtgcgcggggttgtggttcattggacgacgg
gtgatcgccaccgttggacacaacctcaccacgatgcacccggcatcggggtttgctgcc
gaattgtcggccgccggggtggtcatgggagccacggtcctgggtcttccggtttccagc
acgcacattcttatcggcgccgtcctcggcgtcggcatcgtaaaccggtccaccaactgg
ggactgatgaaaccgatcgtgctagcgtgggtcatcacgctgccttcggcggcgatcctc
gcctcggtcggtcttgtcgcgctacgcgcgattttctga

DBGET integrated database retrieval system