KEGG   Mycobacterium canettii CIPT 140070008: BN43_40171Help
Entry
BN43_40171        CDS       T02420                                 

Gene name
scoA
Definition
(GenBank) Putative succinyl-CoA:3-ketoacid-coenzyme A transferase (alpha subunit) ScoA (3-oxo acid:CoA transferase) (OXCT A) (succinyl-CoA:3-oxoacid-coenzyme A transferase)
  KO
K01028  3-oxoacid CoA-transferase subunit A [EC:2.8.3.5]
Organism
mcv  Mycobacterium canettii CIPT 140070008
Pathway
mcv00072  Synthesis and degradation of ketone bodies
mcv00280  Valine, leucine and isoleucine degradation
mcv00650  Butanoate metabolism
mcv01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mcv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    BN43_40171 (scoA)
  09103 Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    BN43_40171 (scoA)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BN43_40171 (scoA)
Enzymes [BR:mcv01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.3  CoA-transferases
    2.8.3.5  3-oxoacid CoA-transferase
     BN43_40171 (scoA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CoA_trans
Motif
Other DBs
NCBI-ProteinID: CCK56554
Position
complement(2872915..2873661)
Genome map
AA seq 248 aa AA seqDB search
MDKVVATAAEAVADIANGSSLAVGGFGLCGIPEALIAALVDSGVTDLETVSNNCGIDGVG
LGLLLQHKRIRRTVSSYVGENKEFARQFLAGELEVELTPQGTLAERLRAGGMGIPAFYTP
AGVGTQVADGGLPWRYDASGGVAVVSPAKETREFDGVTYVLERGIRTDFALVHAWQGDRH
GNLMYRHAAANFNPECASAGRITIAEVEHLVEPGEIDPATVHTPGVFVHRVVHVPNPAKK
IERETVRQ
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atggacaaggtggtggccaccgccgcggaggcggtcgcagacatagccaacgggtcgtcg
cttgcggttggtggattcgggctttgcggcatccccgaagcactgatcgcagcgttggtg
gatagcggtgtcaccgacctggaaacagtctcgaacaactgcggaatcgacggtgttggt
ctgggactattgttgcaacacaagcgaattcgccggacagtctcctcctacgtgggggag
aacaaggagttcgcccgccagttcctcgcgggcgagctcgaggtggaactgaccccgcag
ggcacgctggccgagcggttgcgggccggagggatgggcataccggccttctatacaccg
gcaggggtcggtacccaggtcgccgacggcgggttgccgtggcgctacgacgcctcgggc
ggggtggcggtggtgtcgccggccaaggagactcgggagttcgatggtgtcacctatgtc
ctcgagcgggggatccggaccgacttcgcactggtgcatgcctggcagggggaccggcac
ggcaacctgatgtaccgccacgccgcggccaacttcaacccggagtgcgcatccgcaggc
aggatcacgatcgccgaggtcgagcacttggtcgagccgggtgagatcgaccctgccacc
gtacacaccccgggcgtgtttgtgcaccgggtggttcatgtgcccaaccccgccaagaag
atcgagagggagacggtgcggcaatga

DBGET integrated database retrieval system