KEGG   Mycobacterium canettii CIPT 140070008: BN43_60327Help
Entry
BN43_60327        CDS       T02420                                 

Gene name
sapM
Definition
(GenBank) Acid phosphatase (acid phosphomonoesterase) (phosphomonoesterase) (glycerophosphatase)
  KO
K21302  phosphatidylinositol-3-phosphatase [EC:3.1.3.64]
Organism
mcv  Mycobacterium canettii CIPT 140070008
Pathway
mcv00562  Inositol phosphate metabolism
mcv01100  Metabolic pathways
mcv05152  Tuberculosis
Brite
KEGG Orthology (KO) [BR:mcv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    BN43_60327 (sapM)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    BN43_60327 (sapM)
Enzymes [BR:mcv01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.64  phosphatidylinositol-3-phosphatase
     BN43_60327 (sapM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Phosphoesterase Sulfatase
Motif
Other DBs
NCBI-ProteinID: CCK57370
Position
3732402..3733301
Genome map
AA seq 299 aa AA seqDB search
MLRGIQALSRRLTRVYRALAVIGVLAASLLASWVGAVPQVGLAASALPTFAHVVIVVEEN
RSQAAIIGNKSAPFINSLAANGAMMAQAFAETHPSEPNYLALFAGNTFGLTKNTCPVNGG
ALPNLGSELLSAGYTFMGFAEDLPAVGSTVCSAGKYARKHVPWVNFSNVPATLSVPFSAF
PKPQNYPGLPTVSFVIPNADNDMHDGSIAQGDAWLNRHLSAYANWAKTNNSLLVVTWDED
DGSSRNQIPTVFYGAHVRPGTYNETISHYNVLSTLEQIYGLPKTGYATNAPPITDIWGD
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgctccgcggaatccaggctctcagccggcgcctgaccagggtataccgtgccttggcg
gtgatcggtgtcctggcagcatcgttgctggcctcatgggtcggcgctgtcccacaagtg
ggtctggcagcaagcgccctgccgaccttcgcgcacgtggtcatcgtggtagaggagaac
cgctcgcaggccgccatcatcggtaacaagtcggctcccttcatcaattcgctggccgcc
aacggcgcgatgatggcccaggcgttcgccgaaacacacccgagcgaaccgaactacctg
gcactgttcgctggcaacacattcgggttgacgaagaacacctgcccggtcaacggcggc
gcgctgcccaacctgggttctgagttgctcagcgccggttacacattcatggggttcgcc
gaagacttgcctgcggtcggctccacggtgtgcagtgcgggcaaatacgcacgcaaacac
gtgccgtgggtcaacttcagtaacgtgccggcgacactgtcggtgccgttttcggcattt
ccgaagccgcagaattaccccggcctgccgacggtgtcgtttgtcatccctaacgccgac
aacgacatgcacgacggctcgatcgcccaaggcgacgcctggctgaaccgccacctgtcg
gcatatgccaactgggccaagacaaacaacagcctgctcgttgtgacctgggacgaagac
gacggcagcagccgcaatcagatcccgacggtgttctacggcgcgcacgtgcggcccgga
acttacaacgagaccatcagccactacaacgtgctgtccacattggagcagatctacgga
ctgcccaagacgggttatgcgaccaatgctccgccaataaccgatatttggggcgactag

DBGET integrated database retrieval system