KEGG   Mycobacterium canettii CIPT 140070008: BN43_60336Help
Entry
BN43_60336        CDS       T02420                                 

Gene name
sdhD
Definition
(GenBank) Putative succinate dehydrogenase (hydrophobic membrane anchor subunit) SdhD (Succinic dehydrogenase) (Fumarate reductase) (Fumarate dehydrogenase) (Fumaric hydrogenase)
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
mcv  Mycobacterium canettii CIPT 140070008
Pathway
mcv00020  Citrate cycle (TCA cycle)
mcv00190  Oxidative phosphorylation
mcv00650  Butanoate metabolism
mcv01100  Metabolic pathways
mcv01110  Biosynthesis of secondary metabolites
mcv01120  Microbial metabolism in diverse environments
mcv01130  Biosynthesis of antibiotics
mcv01200  Carbon metabolism
Module
mcv_M00009  Citrate cycle (TCA cycle, Krebs cycle)
mcv_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
mcv_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:mcv00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BN43_60336 (sdhD)
   00650 Butanoate metabolism
    BN43_60336 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    BN43_60336 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt
Motif
Other DBs
NCBI-ProteinID: CCK57379
Position
3739641..3740075
Genome map
AA seq 144 aa AA seqDB search
MSAPVRQRSHDRPASLDNPRSPRRRAGMPNFEKFAWLFMRFSGVVLVFLAIGHLFIMLIW
DNGVYRLDFNFVAQRWASPFWQTWDLLLLWLAQLHGGNGLRTIIDDYSRKDATRFWLNSL
LVLSMLFTLMLGTYVIVTFDPNIS
NT seq 435 nt NT seq  +upstreamnt  +downstreamnt
atgagcgccccggtcagacagcgcagccatgaccgtccagccagcctggacaacccacga
tcaccacggcggcgtgccggcatgcccaacttcgagaaattcgcctggctgttcatgcgg
ttttccggtgttgtgttggtgttcctggcgatcgggcacctgttcatcatgctgatttgg
gacaacggcgtgtatcgcctggacttcaacttcgttgcccaacgctgggcgtcgccgttc
tggcagacctgggatctgctgttgttgtggctggcgcagctgcacggcggcaacggtctg
cgcaccatcattgacgactacagccgcaaagacgccacccgattctggctgaactcgttg
ctggtgttgtccatgctgttcaccctgatgctgggaacctacgtgatagtgacattcgac
ccgaacatctcctga

DBGET integrated database retrieval system