KEGG   Mycobacterium canettii CIPT 140070008: BN43_90064Help
Entry
BN43_90064        CDS       T02420                                 

Gene name
nat
Definition
(GenBank) Arylamine N-acetyltransferase
  KO
K00622  arylamine N-acetyltransferase [EC:2.3.1.5]
Organism
mcv  Mycobacterium canettii CIPT 140070008
Pathway
mcv00983  Drug metabolism - other enzymes
mcv01100  Metabolic pathways
mcv01110  Biosynthesis of secondary metabolites
mcv01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mcv00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00232 Caffeine metabolism
    BN43_90064 (nat)
  09111 Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    BN43_90064 (nat)
   00983 Drug metabolism - other enzymes
    BN43_90064 (nat)
Enzymes [BR:mcv01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.5  arylamine N-acetyltransferase
     BN43_90064 (nat)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acetyltransf_2
Motif
Other DBs
NCBI-ProteinID: CCK57628
Position
complement(4019078..4019929)
Genome map
AA seq 283 aa AA seqDB search
MALDLTAYFDRINYRGATDPTLDVLQDLVTVHSRTIPFENLDPLLGVPVDDLSPQALADK
LVLRRRGGYCFEHNGLMGYVLAELGYRVRRFAARVVWMLAPDAPLPPQTHTLLGVTFPGS
GGCYLVDVGFGGQTPSSPLRLETGAVQPTTHEPYRLEDRVDGFVLQAMVRDTWQTLYEFT
TQTRPQIDLKVASWYASTHPASKFVTGLTAAVITDDARWNLSGRDLAVHRAGGTEKIRLA
DAAAVVDTLSERFGINVADIGERGALETRIDELLARQPGADAP
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atggcactggatctgaccgcgtacttcgatcgcatcaactatcgcggcgctaccgatcca
accctggatgttctgcaggatctggtgaccgtgcacagtcgaacgattccgttcgagaac
ctcgacccgctgctgggggtgccggtcgacgacctcagtccacaggcgctggccgacaag
ctggtacttcggcgccgaggcgggtactgctttgagcacaacgggctgatgggttatgtg
ctggccgaactcggctatcgggtgcgccgattcgccgcccgcgtcgtctggatgctcgcg
ccggacgcgcccctgccgccgcagacgcacaccctgctgggggtcacgttccccggctcg
ggcggatgctatctcgtcgacgtcggattcggcggccaaacaccgagctcaccgcttcgc
ctcgaaaccggcgccgtccagccgacaacgcacgaaccttatcggctcgaggaccgcgtc
gacggctttgtcttgcaggcgatggtccgggacacatggcagacactgtacgaattcacc
acccagacccgcccgcagatcgatctgaaagtggccagctggtacgcctcaacacacccg
gcatcgaagttcgtcacgggactgaccgccgcggtgatcaccgacgacgcccggtggaac
ctatctggccgcgaccttgccgttcaccgcgccggtggtaccgagaagatccgccttgcc
gatgcggcagcggttgtcgacaccctgagtgaacggttcgggatcaacgtggcagatatc
ggcgagcgcggcgcgctcgagacgcgcatcgacgagctattggctcggcagccaggagcc
gatgcgccgtaa

DBGET integrated database retrieval system