KEGG   Microbacterium chocolatum: A8L33_00575Help
Entry
A8L33_00575       CDS       T04340                                 

Definition
(GenBank) aspartate--tRNA(Asn) ligase
  KO
K01876  aspartyl-tRNA synthetase [EC:6.1.1.12]
Organism
mcw  Microbacterium chocolatum
Pathway
mcw00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:mcw00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    A8L33_00575
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:mcw01007]
    A8L33_00575
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:mcw03016]
    A8L33_00575
   03029 Mitochondrial biogenesis [BR:mcw03029]
    A8L33_00575
Enzymes [BR:mcw01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.12  aspartate---tRNA ligase
     A8L33_00575
Amino acid related enzymes [BR:mcw01007]
 Aminoacyl-tRNA synthetase
  Class II (A)
   A8L33_00575
Transfer RNA biogenesis [BR:mcw03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    A8L33_00575
 Prokaryotic type
   Other AARSs
    A8L33_00575
Mitochondrial biogenesis [BR:mcw03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    A8L33_00575
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_2 tRNA_anti-codon tRNA-synt_2d MS_channel
Motif
Other DBs
NCBI-ProteinID: ANG84102
UniProt: A0A0M8MNR7
Position
123430..124770
Genome map
AA seq 446 aa AA seqDB search
MSERVLVKQLQSRADGPVSVSGWVETVRDQKKVQFVILRDETGAVQLVNPATRPAEDGTE
QDAAALALTDTISNLATGTFLTVQGELKHDERVKLGGVEIKIGGLDIAAAALPETPIAAD
SGLDKRMDWRFLDLRQRRNNLIFRVQTTLEHAMRTYWIERDYIEVHSPKLMASPSESNAE
LFEVPYFEEKTAYLAQSPQFFKQMAQVAGFGKIFEIAPAFRADPSFTSRHATEFTSIDAE
ISWVESHEDVARMQEELLQTAIRAVKDKHGDEIQELFGLEIVVPEVPFPRIPLAEAREIV
AARGYDIPRTDGDLDPEGERQIAAHVQETFGHQFVFITDYHPEIRAFYHMRDEETGLTKS
YDLLFNGVEITTGAQREHRVDVLIEQAKEKGLDPEHLDFYLDFFRYGAPPHGGFGMGLAR
VLMLLLGQDSIREVTYLFRGPTRLAP
NT seq 1341 nt NT seq  +upstreamnt  +downstreamnt
gtgagtgaacgcgttctggtgaagcagctgcaatcgcgggccgacggcccggtgtccgtg
tcggggtgggtcgaaaccgtccgtgaccagaagaaggtgcagttcgtcatcctgcgcgat
gagacgggcgccgtgcagctggtcaatccggcgacgcgtccggccgaggacggcacggag
caggatgccgcggctttggccctcaccgacaccatctcgaacctcgccacgggcaccttc
ctcacggtgcagggcgaactcaagcacgacgagcgcgtgaagctcggcggcgtcgagatc
aagatcggcgggctcgacatcgccgcggcagcgctccccgagaccccgatcgccgcggac
tcgggcctcgacaagcgcatggactggcgcttcctcgacctgcgccagcgccgcaacaac
ctcatcttccgcgtgcagacgacgctcgagcacgccatgcgcacctactggatcgagcgc
gactacatcgaggtgcactcccccaagctcatggcgagcccgtcggagtccaacgccgag
ctgttcgaggtgccctacttcgaggagaagacggcctacctcgcgcagagcccgcagttc
ttcaagcagatggcgcaggttgccggcttcgggaagatcttcgagatcgcccccgccttc
cgcgccgatccctcgttcacctcgcgtcacgcgacggagttcacctccatcgacgccgag
atcagctgggtcgagtcccacgaggacgtcgcgcgcatgcaggaggagctcctgcagacc
gccatccgcgcggtgaaggacaagcacggcgacgagatccaggagctcttcgggctcgag
atcgtcgtccccgaggtccccttcccccgcatccccctcgccgaggcgcgcgagatcgtc
gcggctcgcggatacgacatcccgcgtaccgacggcgacctcgaccccgaaggcgagcgt
cagatcgccgcccacgtccaggaaaccttcggtcaccagttcgtcttcatcaccgactac
caccccgagatccgcgcgttctatcacatgcgcgacgaggagaccgggctgacgaagtcg
tacgacctgctgttcaacggcgtcgagatcaccaccggtgcgcagcgcgagcaccgcgtg
gacgtcctcatcgagcaggccaaggaaaagggactcgaccccgagcacctggacttctac
ctcgacttcttccgctacggcgccccgccgcacggtggattcggcatgggcctcgcccgc
gtgctgatgctgctgctcggccaggactcgatccgcgaggtcacctacctcttccgcggg
ccgacgcgcctcgctccctga

DBGET integrated database retrieval system