KEGG   Microbacterium chocolatum: A8L33_07245Help
Entry
A8L33_07245       CDS       T04340                                 

Definition
(GenBank) mannitol-1-phosphate 5-dehydrogenase
  KO
K00009  mannitol-1-phosphate 5-dehydrogenase [EC:1.1.1.17]
Organism
mcw  Microbacterium chocolatum
Pathway
mcw00051  Fructose and mannose metabolism
mcw01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mcw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    A8L33_07245
Enzymes [BR:mcw01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.17  mannitol-1-phosphate 5-dehydrogenase
     A8L33_07245
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mannitol_dh_C Mannitol_dh
Motif
Other DBs
NCBI-ProteinID: ANG85206
UniProt: A0A0M8MNM3
Position
complement(1503460..1504626)
Genome map
AA seq 388 aa AA seqDB search
MKAVHFGAGNIGRGFVGLLLHEGGYELVFSDVAAPLVDAINAVDRYTVREVGPGGVDTVV
TGFRAINSAENAEELIDEIAGANVVTTAVGPTVLRFVAPHIVAGLALRDPSSPPLQIMAC
ENAINATDVLREEMTVAAGGAWDALEGRAVFANTAVDRIVPAQPEGGGVDVTVEPFFEWA
IERGPFGVEPPVIPRAHFVDDLAPYIERKLFTVNTGHATAAYFGAAAGSDTIAAALADDT
IAGRVDAALRETSALLEVKHGLDAEELAGYRATILDRFRNDVLPDTVWRVGRQPLRKLSR
HERFIGPAAQAIERGLGVDGLLDAISAALAFDDDEDAQSVDLQRMLRTQDAASVTAEVTG
LEADHPLFARVEAVVAARQRDVGAGADA
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgaaggccgtccacttcggcgccggcaacatcggtcgcggcttcgtcggcctcctcctc
cacgagggcgggtacgagctggtcttctcggacgtcgcggcgccgctggtcgacgcgatc
aacgccgtcgaccgctacacggtgcgcgaggtcggtccgggaggcgtcgacactgtcgtc
acggggttccgcgcgatcaactcggccgagaacgccgaagagctgatcgacgagatcgcg
ggcgcgaacgtggtcaccaccgccgtcggcccgaccgtgctgcgcttcgtcgcgccgcac
atcgtcgcggggctcgcgctgcgtgacccctcgtcgccgccgctgcagatcatggcgtgc
gagaacgcgatcaacgccaccgacgtcctccgcgaggagatgacggtcgccgcgggcggc
gcgtgggacgcactcgagggccgcgccgtgttcgccaacaccgcggtggatcgcatcgtc
cccgcccagcccgagggcggcggagtcgacgtcaccgtcgagccgttcttcgagtgggcg
atcgagcgaggccccttcggcgtcgagccgccggtcatcccccgggcgcacttcgtcgac
gacctcgcgccgtacatcgagcggaagctcttcacggtgaacaccgggcacgccaccgcc
gcctacttcggtgccgccgccggatccgacacgatcgccgcggcgctcgccgacgacacc
atcgccggacgcgtggatgccgcgctccgcgaaacgtcggcgctgctggaagtcaagcac
gggctcgacgccgaggagctcgcgggctaccgcgcgacgatcctcgatcggttccgcaac
gacgtcctcccggacacggtgtggcgcgtcggacgtcagccgctgcggaaactctcccgg
cacgagcggttcatcggtcccgccgcgcaggcgatcgagcgtgggctcggcgtggacggg
ctcctcgacgcgatctcggcggcgctcgcgttcgacgacgacgaagacgcccagtccgtc
gatctccagcggatgctgcgcacccaggatgcggcatccgtcaccgcggaggtgaccgga
ctggaagccgaccatcccctgttcgcgcgggtcgaggcggtcgtcgcggcgcggcagcgg
gacgtcggagcaggtgccgacgcgtag

DBGET integrated database retrieval system