KEGG   Microbacterium chocolatum: A8L33_10860Help
Entry
A8L33_10860       CDS       T04340                                 

Definition
(GenBank) glycosyl hydrolase family 3
  KO
K01207  beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
mcw  Microbacterium chocolatum
Pathway
mcw00520  Amino sugar and nucleotide sugar metabolism
mcw01100  Metabolic pathways
mcw01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:mcw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    A8L33_10860
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    A8L33_10860
Enzymes [BR:mcw01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     A8L33_10860
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_3
Motif
Other DBs
NCBI-ProteinID: ANG85819
UniProt: A0A0N0RR96
Position
complement(2296143..2297354)
Genome map
AA seq 403 aa AA seqDB search
MPSPIRAGAVGLFLAASIVLGSLSSVHAAEDPPDVTETTGARGVAVAGRSDELAAHAEAL
VSRMNTAERAASVVMGHLPTTDPAVLEQYMRETGIGGFILMGANIPASEGELRAVTSALQ
VDPELPPLIGIDQEGGDVSRLSWDDNASARTLKNAPVDDAGTAFAARASLVARAGATVNF
GVVADVTDDPSMFIYARALGATPQSAADHVRAAVRGEAGLVLSTAKHFPGHGAAPGDSHQ
GIPTTDMTRAEWETRDGAPFRAAIEAGVPLVMLGHLAYTDVDTAPASLSSAWHDILRDDL
GFTGVAITDDLGMLQASGIAAYDDPVANAVSALAAGNDMVLSVMFTTADTAPAMVAGITA
AVEEGTLSSGRLEEAATRVMALRLSTAAQGDTLMPCTECTAIP
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgccgtcaccgatacgcgcgggcgccgtcgggctcttcctcgccgcgagcatcgtgctg
ggctccctcagctccgtacatgccgcggaggacccgccggacgtcaccgagacgacgggg
gcgcgcggcgtcgccgtcgcggggagatcggatgagctcgcggcgcacgccgaggcgctc
gtgtcacggatgaacaccgccgagcgcgcggcgagcgtcgtgatggggcacctgccgacg
acggacccggccgtcctcgagcagtacatgcgcgaaacgggcatcggggggttcatcctg
atgggcgcgaacatccccgcctcggagggcgagctgcgcgccgtcacctcggcgttgcag
gtcgatccggagctcccaccgctcatcggcatcgaccaggagggcggcgacgtctcccgc
ctttcgtgggacgacaatgcctccgcgcggactctgaagaacgccccggtcgacgacgcg
ggcaccgcgttcgccgcccgagcctccctcgtcgctcgcgcgggggcgaccgtgaacttc
ggcgtcgtcgccgatgtgaccgacgacccctccatgttcatctatgcgcgtgcgctcggc
gcaacaccgcagtccgccgcggatcacgtccgtgccgccgtccggggcgaagcgggtctc
gtgctgtccaccgcgaagcacttccccgggcacggagccgcccccggggattcccatcag
gggatcccgaccaccgacatgacgcgtgcagagtgggagacgcgtgacggtgcgccgttc
cgcgcggccatcgaggccggcgtgccgctggtcatgctcggccacctcgcctacaccgat
gtcgataccgcaccggcgtccctctcctccgcatggcacgacatcctgcgggacgacctc
ggattcaccggtgtcgcgatcaccgacgacctcgggatgctccaggcctccggcatcgcc
gcatacgacgacccggtcgccaacgcggtgtccgcgcttgcggcggggaacgacatggtg
ctgtcggtgatgttcaccacagccgatacggcgccggcgatggtggccggcatcaccgcc
gcggtggaggagggaaccctgtcctcaggtcggctcgaagaggccgccacccgggtgatg
gcgctgcgcctctccaccgccgcgcagggcgacacgctcatgccctgcacggaatgcacg
gcgatcccctaa

DBGET integrated database retrieval system