KEGG   Mycobacterium canettii CIPT 140070010: BN42_20020Help
Entry
BN42_20020        CDS       T02421                                 

Gene name
tam
Definition
(GenBank) Trans-aconitate 2-methyltransferase
  KO
K00598  trans-aconitate 2-methyltransferase [EC:2.1.1.144]
Organism
mcx  Mycobacterium canettii CIPT 140070010
Brite
KEGG Orthology (KO) [BR:mcx00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BN42_20020 (tam)
Enzymes [BR:mcx01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.144  trans-aconitate 2-methyltransferase
     BN42_20020 (tam)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_23 Methyltransf_25 Methyltransf_11 Methyltransf_31 Methyltransf_12 MTS FtsJ Methyltransf_2 Methyltransf_32 MetW CMAS
Motif
Other DBs
NCBI-ProteinID: CCK58316
Position
376780..377565
Genome map
AA seq 261 aa AA seqDB search
MWDPDVYLAFSGHRNRPFYELVSRVGLERARRVVDLGCGPGHLTRYLARRWPGAVIEALD
SSPEMVAAAAERGIDATTGDLRDWKPKPDTDVVVSNAALHWVPEHSDLLVRWVDELAPGS
WIAVQIPGNFETPSHAAVRALARREPYAKLMRDIPFRVGAVVQSPAYYAELLMDTGCKVD
VWETTYLHQLTGEHPVLDWITGSALVPVRERLSDESWQQFRQELIPLLNDAYPPRADGST
IFPFRRLFMVAEVGGARRSGG
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgtgggatcccgacgtctacctggctttttcgggtcatcgcaaccgcccgttctacgag
ttggtgtcacgggtgggtctcgagcgggcgcgccgcgtggtcgacctggggtgcgggccc
ggccacctgacacgctacctggcacgacgatggcccggcgcggtgatcgaggctctggac
agctcaccggagatggtcgctgccgcggccgaacgcgggatcgacgccaccaccggtgac
ctgcgggactggaaaccaaagcccgacaccgatgtggtggtgagcaacgctgcgttgcat
tgggtgcctgagcattccgacctgttggtccggtgggtcgacgagctggcgccgggatca
tggatcgctgttcagatccccggcaacttcgagacgccgtcgcacgccgcggtacgggcg
ttggcccgccgcgaaccgtatgcaaagctaatgcgcgacataccttttcgtgtgggcgcg
gtggtccaatctccggcgtattacgcggagctactgatggacaccggctgcaaggtcgac
gtgtgggagaccacgtacctacaccagctgaccggcgagcacccggtgttggactggatc
accggaagcgcgctggtcccagtgcgtgagcggctcagcgatgagagctggcagcagttt
cggcaggagctcattccgctgctgaacgacgcctacccgccacgggccgacggtagcacc
atctttcccttccggcggctgttcatggtcgccgaagttggtggcgcgcggcgctcaggt
gggtag

DBGET integrated database retrieval system