KEGG   Mycobacterium canettii CIPT 140070010: BN42_30228Help
Entry
BN42_30228        CDS       T02421                                 

Gene name
echA
Definition
(GenBank) Putative enoyl-CoA hydratase EchA13 (enoyl hydrase) (unsaturated acyl-CoA hydratase) (crotonase)
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
mcx  Mycobacterium canettii CIPT 140070010
Pathway
mcx00071  Fatty acid degradation
mcx00280  Valine, leucine and isoleucine degradation
mcx00281  Geraniol degradation
mcx00310  Lysine degradation
mcx00360  Phenylalanine metabolism
mcx00362  Benzoate degradation
mcx00380  Tryptophan metabolism
mcx00410  beta-Alanine metabolism
mcx00627  Aminobenzoate degradation
mcx00640  Propanoate metabolism
mcx00650  Butanoate metabolism
mcx00903  Limonene and pinene degradation
mcx00930  Caprolactam degradation
mcx01100  Metabolic pathways
mcx01110  Biosynthesis of secondary metabolites
mcx01120  Microbial metabolism in diverse environments
mcx01130  Biosynthesis of antibiotics
mcx01212  Fatty acid metabolism
Module
mcx_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:mcx00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    BN42_30228 (echA)
   00650 Butanoate metabolism
    BN42_30228 (echA)
  Lipid metabolism
   00071 Fatty acid degradation
    BN42_30228 (echA)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BN42_30228 (echA)
   00310 Lysine degradation
    BN42_30228 (echA)
   00360 Phenylalanine metabolism
    BN42_30228 (echA)
   00380 Tryptophan metabolism
    BN42_30228 (echA)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BN42_30228 (echA)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    BN42_30228 (echA)
   00281 Geraniol degradation
    BN42_30228 (echA)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BN42_30228 (echA)
   00627 Aminobenzoate degradation
    BN42_30228 (echA)
   00930 Caprolactam degradation
    BN42_30228 (echA)
Enzymes [BR:mcx01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     BN42_30228 (echA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: CCK60027
Position
complement(2297718..2298674)
Genome map
AA seq 318 aa AA seqDB search
MSVGGVSPVDRRSDGQRCQRPREFEYIRYETIDDGRIAAITLDRPQLRNAQTRGMLVELG
AAFELAEADDTVRVVILRAAGPAFSAGHDLGSADDIRERSPGPDQHPSYRCNGASFGGVE
SRNRQEWHYYFENTKRWRNLRKITIAQVHGAVLSAGLMLAWCCDLIVASEDTVFADVVGT
RLGMCGVEYFGHPWEFGPRKTKELLLTGDCIDADEAHALGMVSKVFPVDELATSTIEFAR
RIAKVPTMAALLIKESVNQTVDAMGFSAALDGCFKIHQLNHAHWGEVTGGKLSYGTVEYG
LEDWRATPQIRPAIKQRP
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgtccgtcggcggggtcagtccggtcgatcgccgatcggacgggcaacgctgccagcgg
ccccgggagttcgaatacatccgctacgaaacgatcgacgatgggcgcatcgccgcaatc
accctggaccgcccacaactacgcaacgcccagacccggggcatgctggtcgagctgggc
gccgcattcgaactcgccgaggctgacgacaccgtcagggtggtgatcctgcgggccgcc
ggacccgccttctccgccggtcacgacctcggatcggctgacgatatccgggaacgctcg
cccggaccggaccagcaccccagctaccggtgcaacggggcaagtttcggcggggtcgag
tcacgcaaccgccaggagtggcactactacttcgaaaacaccaagcggtggcgcaacctg
cgcaagatcaccatcgcccaggtgcacggggcggtgttgtcggcggggttgatgctggcc
tggtgctgcgatctgatcgtcgccagcgaggacaccgtgttcgccgacgtggtcggcacc
cggctgggcatgtgcggggtcgagtacttcggccatccgtgggagttcgggccgcgcaag
accaaggaactgctgctcaccggcgactgcatagacgccgacgaggcccacgcgctgggg
atggtcagcaaggtgtttcccgttgacgaactcgcgaccagcacaatcgaattcgcgcgt
cgaatcgcgaaggtaccgacgatggccgcactgctgatcaaggaatcggtgaaccaaacc
gtcgatgccatggggttttccgccgcactggacggttgcttcaagattcaccagctcaat
cacgcgcactggggcgaagtcaccggcggcaagctgtcctacggaacggtcgagtacgga
ctggaggattggcgcgccacaccgcagatccggcccgcgatcaagcagcggccctga

DBGET integrated database retrieval system