KEGG   Mycobacterium canettii CIPT 140070010: BN42_41315Help
Entry
BN42_41315        CDS       T02421                                 

Gene name
manB
Definition
(GenBank) d-alpha-D-mannose-1-phosphate guanylyltransferase ManB
  KO
K00966  mannose-1-phosphate guanylyltransferase [EC:2.7.7.13]
Organism
mcx  Mycobacterium canettii CIPT 140070010
Pathway
mcx00051  Fructose and mannose metabolism
mcx00520  Amino sugar and nucleotide sugar metabolism
mcx01100  Metabolic pathways
mcx01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mcx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    BN42_41315 (manB)
   00520 Amino sugar and nucleotide sugar metabolism
    BN42_41315 (manB)
Enzymes [BR:mcx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.13  mannose-1-phosphate guanylyltransferase
     BN42_41315 (manB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 Hexapep DUF4954 Queuosine_synth
Motif
Other DBs
NCBI-ProteinID: CCK61385
Position
complement(3782919..3783998)
Genome map
AA seq 359 aa AA seqDB search
MATHQVDAVVLVGGKGTRLRPLTLSAPKPMLPTAGLPFLTHLLSRIAAAGIEHVILGTSY
KPAVFEAEFGDGSALGLQIEYVTEEHPLGTGGGIANVAGKLRNDTAMVFNGDVLSGADLA
QLLDFHQSNRADVTLQLVRVGDPRAFGCVPTDEEDRVVAFLEKTEDPPTDQINAGCYVFE
RNVIDRIPQGREVSVEREVFPALLADGDCKIYGYVDASYWRDMGTPEDFVRGSADLVRGI
APSPALRGHRGEQLVHDGAAVSPGALLIGGTVVGRGAEIGPGTRLDGAVIFDGVRVEAGC
VIERSIIGFGARIGPRALIRDGVIGDGADIGARCELLSGARVWPGVFLPDGGIRYSSDV
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
ttggcaactcaccaagtcgatgcggtggtcctggtcggtggcaagggcacccgactgcgg
ccgttgacgctgtcggcgcccaagccaatgctgcctaccgccggactgccgttcctcacc
catctgctgtcgcggatcgccgcagcgggcatcgagcacgtgatcctgggtacgtcctac
aagcccgcagtcttcgaagcggagttcggcgacgggtccgcactgggcctacagatcgag
tacgtgaccgaggagcatcccttggggactggcggcggcatcgccaacgttgccggcaag
ctgcgcaacgacaccgcgatggtgtttaacggcgatgtgctgtccggcgccgatctggcc
caactgctggacttccaccaaagcaatcgagccgatgtcacgctgcaactggtgcgggtg
ggcgacccgcgggcattcggctgcgtacccaccgacgaggaggaccgcgtagtcgccttt
ctggagaagacggaggatccgccgaccgaccagatcaatgccggctgctatgtcttcgaa
cgcaacgtcatcgaccggattccgcagggccgggaggtttcggtggaacgcgaggtgttc
ccggccttgctcgccgacggcgactgcaagatctatggctatgtcgatgccagctattgg
cgggacatgggcacaccggaagacttcgttcgcggatcggcggatctggtgcgcggtatc
gccccgtctccggccttgcgtggtcaccgcggtgagcagttggtgcacgacggtgcggcg
gtatctcccggtgcgttgctgattggcggcaccgtcgtggggcgtggtgccgaaatcggc
cccggcaccagattggacggcgcggtcatcttcgacggtgtccgggtggaggccgggtgc
gtgatcgagcgttcgatcatcggcttcggtgcccgcatcggaccgcgggcgttaatccgc
gacggtgtgatcggtgacggcgccgacatcggcgcgcgctgcgagttgttgagtggtgcc
cgggtatggcccggtgtctttcttcccgacggcgggatccgttactcgtccgacgtttga

DBGET integrated database retrieval system