KEGG   Mycoplasma cynos: MCYN_0883Help
Entry
MCYN_0883         CDS       T02424                                 

Gene name
MCYN0883
Definition
(GenBank) Exodeoxyribonuclease V, alpha subunit
  KO
K03581  exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
mcy  Mycoplasma cynos
Pathway
mcy03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:mcy00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    MCYN_0883 (MCYN0883)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:mcy03400]
    MCYN_0883 (MCYN0883)
Enzymes [BR:mcy01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     MCYN_0883 (MCYN0883)
DNA repair and recombination proteins [BR:mcy03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     MCYN_0883 (MCYN0883)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_30 AAA_19 Viral_helicase1 UvrD_C_2 SH3_13 AAA_11 DUF2075 NTPase_1 HHH_4 AAA_22 RsgA_GTPase AAA_16 Helicase_RecD AAA NACHT DUF815 AAA_24 AAA_5 PhoH ABC_tran AAA_28 RNA_helicase
Motif
Other DBs
NCBI-ProteinID: CCP24615
UniProt: L0RYR6
Position
complement(995448..997787)
Genome map
AA seq 779 aa AA seqDB search
MEKIVLKENEELISGRIIKTLKENKPQGWGLFMVETIEKEKIVIYMSKNIPKIYEDYDFV
ITKSNRGANNTYILNNYFKVQKKIDKEMELLQYLKKTPKVGFAAIDKINKKYTFKGFYKS
IKENEIFNEDFADFLNQQQKENILVVYKENEEKILNLISDTEEIDNDLFFFELNKLQNLY
LKLLEFHGKDVNFKTFYKSNNPYKLYLENQFPLKEIDIFALALGWSESSFERLEAYLNVL
MIKLEDNNSTYIDKNEIISLLQNELNFAVTEPILNDFLDNLVKQGKLIAIDNLICRKEMY
IKEEFISSTLLKISKRKIVTLEKIDENEISYLSDNQREAYYSFLNSNISIITGGPGTGKS
NLIKHIYNTLKKEGYVYNEDFIVLAPTGRAAANISFKNGFTSRTIHSFLNIANDEEKINQ
SPKEYDNFKILIIDEFSMVNINVFYLLLSMCRKIKKIVLLGDVDQLPAIGPGNLLTDLIN
SNKFRTMYLKQNFRSESSEIIEYINFINCIGDFENESHNEQLVNFIKDEYKINDLNFKLS
EFKNTIYTKFCDFYGNSLKQKNIEMYIFNDFLKDISTLFEEKVKIYGVENVVILCPIYKG
SYGIDKINKIIQNKFNREGKEIFSYKIFDNEFIFKENDKVIQLVNKHEKNISNGDIGFIE
RIEKDNTSKEKELIVVRFETNGKKRYVSYTKDEFKTEVKLAYAITIHKFQGSEINCAIFI
VHPDHSRMLTRKLVYTAASRAIKKLVIFTKYENIYSKIFLKEFLNNKKIITNLLWMLKE
NT seq 2340 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaaatagttttaaaagaaaatgaagaattaatttcaggacgaataataaaaact
ttaaaagaaaacaaacctcaaggttgaggtttgtttatggtcgagacaatagaaaaagaa
aaaatagttatttatatgtcgaaaaacataccgaaaatatatgaagattatgattttgta
attacaaaatcaaatagaggagctaataatacatatattttgaataactattttaaagtt
caaaaaaagatagataaggaaatggaacttcttcaatatcttaaaaaaacaccaaaagtc
ggttttgctgccattgataaaattaataaaaaatatacatttaaaggtttttataaatca
attaaagaaaatgaaatttttaatgaagatttcgctgattttttaaatcaacaacaaaaa
gaaaatattttagtggtttataaagaaaacgaagaaaaaatattgaacttaataagtgat
actgaggaaatagataatgatctgttcttttttgagttaaataaacttcaaaatttatat
ttaaagttgttagaattccatggtaaagatgtaaattttaaaacattttataaatcaaat
aatccttataagttatatttagaaaatcaattcccattaaaagagatagatatatttgca
ttagctttaggatgaagtgaatcttcttttgaaagactagaagcttatttaaacgtgctt
atgattaaattagaagataataattctacatatatagataaaaatgaaataatttcatta
ttgcaaaatgagttaaattttgctgttactgagccgattttaaatgattttttagataat
ttagtaaaacaaggaaaattaattgcaatagataatttaatttgtagaaaagaaatgtac
ataaaagaagaatttatttctagcacattattaaaaataagcaaaagaaaaatagtaaca
ttagaaaagatagatgaaaatgaaatatcttatttatctgataaccaaagagaagcgtat
tattcatttttaaattcaaatattagtataattacgggtggtcctggaacaggaaagagt
aatttaataaagcatatctataacactttaaagaaagaaggctatgtatataatgaagat
tttatagttttagccccaacaggtagagcagcagctaatatttcatttaaaaatggattc
acttctagaactattcatagttttttaaatattgctaatgatgaagaaaaaataaatcaa
agtcctaaagaatatgataattttaaaatattaattattgatgaatttagtatggttaat
attaatgttttttatttattactttccatgtgtagaaagataaaaaaaatagttttatta
ggtgatgtagaccaacttccagctattggtcctggtaatttattaaccgatttaataaat
tcaaataaatttagaacaatgtatttaaaacaaaattttcgctctgaaagttctgaaatt
attgaatacattaattttataaattgtattggtgattttgaaaatgaaagtcataatgaa
caacttgttaattttataaaagatgaatataaaattaacgatttaaattttaaattaagt
gagtttaaaaatacaatttatacaaagttttgtgacttttatggtaattcattaaaacaa
aaaaacatagaaatgtatatttttaatgattttttaaaagatatttcgactttatttgaa
gaaaaagtaaaaatttacggtgttgaaaatgtagttattttatgcccaatttataaaggt
tcatacggcattgacaaaattaataaaattattcaaaataaatttaatagagaaggaaaa
gaaattttttcctataagatctttgataatgaatttatttttaaagaaaacgataaagtt
attcaattagttaataagcatgaaaaaaatatttcaaatggtgatataggctttattgag
agaatagaaaaagataatacatctaaggaaaaagagttaatagttgttaggtttgagaca
aatggtaagaagcgttatgtttcatatacgaaagatgaatttaaaacagaagtaaaatta
gcttatgcgattactattcataaatttcaaggaagtgaaattaattgtgctatttttatt
gttcatccagatcatagtagaatgttaactcgtaagttagtttatacagctgcttctaga
gcgattaaaaaacttgttatatttactaaatatgagaatatttattcaaaaatttttcta
aaagagttcttgaataataaaaaaattatcactaatttattatgaatgttaaaggaataa

DBGET integrated database retrieval system