KEGG   Mycoavidus cysteinexigens: MCB1EB_0351Help
Entry
MCB1EB_0351       CDS       T05801                                 

Definition
(GenBank) ApaG protein
  KO
K06195  ApaG protein
Organism
mcys  Mycoavidus cysteinexigens
Brite
KEGG Orthology (KO) [BR:mcys00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    MCB1EB_0351
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525 ASRT
Motif
Other DBs
NCBI-ProteinID: BBE08512
UniProt: A0A2Z6ESY3
Position
402724..403098
Genome map
AA seq 124 aa AA seqDB search
MSQYEFSISVQANYLPEQSEPEQQQFAFAYTITILNAGQVAAQLIARHWLIVDSENHTQE
IKGLGVVGHQPLLQPGEQFQYTSWAIIATPVGTMRGAYFCVAEDGTRFDAPIPEFVLHMP
RTLH
NT seq 375 nt NT seq  +upstreamnt  +downstreamnt
atgagtcaatatgaattcagtatttcagtgcaggctaattatttaccagaacaatcagag
cctgagcagcagcagttcgcttttgcttacacaatcaccattcttaatgcggggcaagtg
gcagcacagttgattgcgcgtcattggttaattgtcgatagtgaaaatcatacgcaagaa
attaagggcctaggcgtggtggggcatcagccgcttctgcaacccggtgagcaatttcag
tatacgagttgggccatcattgcaacgccagtcggtacgatgcggggcgcatatttttgt
gtggcggaagatggaactcgttttgatgcgcctattccagaattcgttttgcatatgccg
cgcacgttacattga

DBGET integrated database retrieval system