KEGG   Mycoavidus cysteinexigens: MCB1EB_0675Help
Entry
MCB1EB_0675       CDS       T05801                                 

Definition
(GenBank) phosphate transporter
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
mcys  Mycoavidus cysteinexigens
Brite
KEGG Orthology (KO) [BR:mcys00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    MCB1EB_0675
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: BBE08836
UniProt: A0A2Z6ETU6
Position
796627..797637
Genome map
AA seq 336 aa AA seqDB search
MSSIHLGLWVVVFLVAIALIFDFMNGFHDAANSIATVVSTGVLKPHHAVIFAALFNVIAY
FIFHLKVASTVGRGTIDPSIIDHYVVFGALIGAIGWNVITWYYGIPSSSSHALIGGLVGS
ALAKAGPGSLNIDGLCKTIAFIFVSPLLGFFLGSLLMLGVSWLYLRTTPSKVDRRFRRYQ
LISAGLYSLGHGGNDAQKTIGIIWMLLLATGYASATLDAPPMWVIAACYLAIGLGTLFGG
WRIVRTMGQKITKLKPVGGFCAEFGGAISLFLASWLGIPVSTTHTITGAIVGVGATQKLA
AVRWGVAGNIVWAWILTIPASASMAALAWWLGQHFL
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgtcatcgattcatttgggactgtgggttgtcgtctttttagtggcgattgccctaatc
ttcgacttcatgaacggctttcatgacgcggcaaattcgattgccaccgtggtttctacg
ggcgttcttaaaccccatcacgcagtcatatttgcggctttatttaatgtcattgcgtac
tttatttttcatctaaaagtagcgtcaacggtcggccgcggcacgatcgatccatcgatt
attgaccattatgtcgtatttggcgcgcttataggcgccatcggctggaacgtgattact
tggtactatggtattccgtccagttcatcccatgcgctgattgggggtttggtcggctca
gcgttagctaaagcaggtcctggttcgttaaatatcgatggcttatgtaaaaccatcgct
tttatttttgtttcgccgctcctcggcttctttttagggtcgctcttgatgttgggggtg
tcatggctttatttgcgcacgacaccgagcaaggttgatcgacgttttcggcgttatcaa
ttaatctctgctggcctgtatagcctggggcacggtggtaacgatgcgcaaaagaccatc
ggcattatctggatgcttttgctggcaactggctatgcttcagccacgctcgacgcccct
ccaatgtgggtgattgcagcctgctatttggctattggcctgggcacgctctttggcggc
tggcgcatcgtgcggaccatggggcaaaaaattaccaaactaaaaccagtgggcggcttt
tgcgctgaatttggcggtgcgatatcacttttcttggcctcttggctcggcatcccagta
tccactacgcataccattacaggtgcgatagttggcgttggcgctacgcaaaagctggcg
gccgtgcgttggggcgtggcgggcaatatcgtttgggcttggatcttgacgattccagct
tctgcctcaatggcggcgctggcttggtggctgggccagcatttcctgtaa

DBGET integrated database retrieval system