KEGG   Mycoavidus cysteinexigens: MCB1EB_0685Help
Entry
MCB1EB_0685       CDS       T05801                                 

Definition
(GenBank) geranyltranstransferase
  KO
K01776  glutamate racemase [EC:5.1.1.3]
Organism
mcys  Mycoavidus cysteinexigens
Pathway
mcys00471  D-Glutamine and D-glutamate metabolism
mcys01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mcys00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    MCB1EB_0685
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:mcys01011]
    MCB1EB_0685
Enzymes [BR:mcys01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.3  glutamate racemase
     MCB1EB_0685
Peptidoglycan biosynthesis and degradation proteins [BR:mcys01011]
 Precursor biosynthesis
  Racemase
   MCB1EB_0685
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asp_Glu_race
Motif
Other DBs
NCBI-ProteinID: BBE08846
UniProt: A0A2Z6ETW0
Position
complement(802902..803741)
Genome map
AA seq 279 aa AA seqDB search
MESISSHAHAPIGVFDSGVGGLSVLRAIHATLPAESLIYCADSYHAPYGERDNAFIIERT
LAISAWLVQQGVKALVVACNTATAQANHLLREKFNIPIIGIEPGIKPAALYSNSRVAGVL
ATASTLRSEKFHRLITAYAADCRFICQAGSGLVEAIERGETDSDAVSALLKAYLTPMLDA
GADTLVLGSTHFPFLEIAIRRIAGDQLRLIETGEAVARQLTRRLAAQQLCAPPDAKVTLR
LYSTANDGIRLQTLASQFLKTDQIAEHISIPSSSAGALS
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atggagtccatttctagccatgcccacgcgccgattggggtattcgattcaggggtaggc
ggcttgtcagtattacgcgcaattcacgctacgctgcccgccgaatctctgatttattgc
gctgattcatatcatgcgccttatggcgagcgtgataacgcttttattatagagcgcacg
cttgcaatcagcgcctggctcgtgcaacaaggagtcaaggcgctggtggtcgcctgtaat
acagcgaccgcgcaggccaaccacctactgcgcgaaaaattcaatatcccgatcatcggc
attgaacctggcattaagcctgccgccctatactcaaactcacgcgtagccggcgtactg
gctacggccagtactttgcgtagcgaaaaatttcaccgcctaataacggcttatgcagcg
gattgtcgatttatctgccaagcgggctctggactggtggaagcgattgaacgtggcgaa
acagattcagacgcagtgtcagccctgcttaaagcctatcttacgccgatgcttgacgca
ggtgcggatacgctagtgctggggtcaacccatttcccttttcttgagatagcaatccgc
cgtatcgctggcgaccagcttaggttgatcgaaaccggagaagcagtcgcccgccaactc
actcgaagattagcggcccaacagttatgcgcgccgccagatgccaaggtaacgctgcgt
ttgtattcaacggcgaatgatggcatccggctacagacgctggccagccaattcctgaag
accgatcaaatcgctgaacatatcagcattccttcaagttcagctggtgctttaagctaa

DBGET integrated database retrieval system