KEGG   Mycobacterium canettii CIPT 140070017: BN45_20227Help
Entry
BN45_20227        CDS       T02422                                 

Definition
(GenBank) Putative short-chain type dehydrogenase/reductase
  KO
K00076  7-alpha-hydroxysteroid dehydrogenase [EC:1.1.1.159]
Organism
mcz  Mycobacterium canettii CIPT 140070017
Pathway
mcz00121  Secondary bile acid biosynthesis
Brite
KEGG Orthology (KO) [BR:mcz00001]
 09100 Metabolism
  09103 Lipid metabolism
   00121 Secondary bile acid biosynthesis
    BN45_20227
Enzymes [BR:mcz01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.159  7alpha-hydroxysteroid dehydrogenase
     BN45_20227
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR 3HCDH_N NAD_binding_7 Sacchrp_dh_NADP Shikimate_DH
Motif
Other DBs
NCBI-ProteinID: CCK63051
Position
complement(1079986..1080777)
Genome map
AA seq 263 aa AA seqDB search
MILDMFRLDDKVAVITGGGRGLGAAIALAFAQAGADVLIASRTSSELDAVAEQIRAAGRR
AHTVAADLAHPEVTAQLAGQAVGAFGKLDIVVNNVGGTMPNTLLSTSTKDLADAFAFNVG
TAHALTVAAVPLMLEHSGGGSVINISSTMGRLAARGFAAYGTAKAALAHYTRLAALDLCP
RVRVNAIAPGSILTSALEVVAANDELRAPMEQATPLRRLGDPVDIAAAAVYLASPAGSFL
TGKTLEVDGGLTFPNLDLPIPDL
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgatcctggatatgttccgtcttgacgacaaggttgccgtcatcaccggcggcggccgc
ggcctgggagcagccatcgcattggctttcgcccaggccggcgcggatgtcctcatcgct
tcacgaacatcatccgagcttgacgctgtcgccgaacagatccgcgctgccggccgccgc
gcccacaccgttgccgccgatctggcccatcccgaggtgaccgcgcagctggctggtcag
gccgtcggagctttcgggaagctcgacatcgtcgtcaacaacgttggcggcaccatgccc
aacacgctgctaagcacctcgaccaaggacctcgcggacgccttcgccttcaacgtgggc
accgcccacgcgctgaccgtcgcggcggtgccgttgatgctggaacactccggcggcggc
agcgtgatcaacatcagctccaccatgggccggctggcggcgcggggtttcgccgcctac
ggcaccgccaaggccgcacttgcccactacacccggctggcggcgctggacctgtgccca
cgcgtccgggtcaatgcgatcgcgccgggttccatcctgacctcggcgctggaggtggta
gccgccaacgacgagctgcgtgcgccgatggagcaggcgacaccactgcgccggctcggt
gaccccgtcgacattgcagctgcggcagtgtatttggcctctccggcgggcagcttcctg
accggcaagacgttggaggtcgacggcggactcaccttccccaatctcgaccttcccatt
ccggacctgtga

DBGET integrated database retrieval system