KEGG   Mycobacterium canettii CIPT 140070017: BN45_30150Help
Entry
BN45_30150        CDS       T02422                                 

Definition
(GenBank) 3-beta-hydroxysteroid dehydrogenase
  KO
K16045  3beta-hydroxy-Delta5-steroid dehydrogenase / steroid Delta-isomerase [EC:1.1.1.145 5.3.3.1]
Organism
mcz  Mycobacterium canettii CIPT 140070017
Pathway
mcz00984  Steroid degradation
mcz01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mcz00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00984 Steroid degradation
    BN45_30150
Enzymes [BR:mcz01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.145  3beta-hydroxy-Delta5-steroid dehydrogenase
     BN45_30150
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.1  steroid Delta-isomerase
     BN45_30150
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3Beta_HSD Epimerase GDP_Man_Dehyd NAD_binding_10 NAD_binding_4 RmlD_sub_bind Polysacc_synt_2 KR NmrA adh_short
Motif
Other DBs
NCBI-ProteinID: CCK63236
Position
complement(1286660..1287772)
Genome map
AA seq 370 aa AA seqDB search
MLRRMGDASLTTELGRVLVTGGAGFVGANLVTTLLDRGHWVRSFDRAPSLLPAHPQLEVL
QGDITDADVCAAAVDGIDTIFHTAAIIELMGGASVTDEYRKRSFAVNVGGTENLLHAGQR
AGVQRFVYTSSNSVVMGGQNIAGGDETLPYTDRFNDLYTETKVVAERFVLAQNGVDGMLT
CAIRPSGIWGNGDQTMFRKLFESVLKGHVKVLVGRKSARLDNSYVHNLIHGFILAAAHLV
PDGTAPGQAYFINDAEPINMFEFARPVVEACGQRWPRVRISGPAVHWVMTGWQRLHFRFG
FPAPLLEPLAVERLYLDNYFSIAKARRDLGYEPLFTTQQALTECLPYYVSLFEQMKNEAR
AEKTAATVKP
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atgcttcgccgcatgggtgatgcatcgctgacaaccgagctcggccgcgttctggtcacc
ggcggcgcgggcttcgtgggcgccaacctggtgaccaccttgctggaccgcgggcactgg
gtgcgttccttcgaccgcgcgccgtcgctgttgcctgcgcatccgcaactggaggtgctg
caaggggacatcaccgacgcggacgtctgcgccgcggccgtggacggcatcgacacgatc
ttccacaccgcagcgatcatcgagctgatgggcggcgcgtcggtcaccgacgagtaccgc
aaacgtagctttgcggtcaacgtcggcggcaccgagaacctgctgcacgccggccagcgg
gccggggtgcagcggttcgtctacacgtcatccaacagtgtggtgatgggcggccagaac
atcgccggcggtgacgagacgctgccctataccgaccggttcaacgacctctacaccgag
accaaggtggttgccgagcgattcgtgttggcccagaacggtgtcgacggcatgctgacg
tgcgcgatccggcccagcggcatctggggaaacggcgatcagacgatgttccgcaagctg
ttcgaaagtgtgctcaagggccacgtcaaggtgctggtcgggcgcaagtcggcccggctg
gataactcttacgtgcacaacctgattcacggtttcatcttggccgctgcccatctggtg
ccggacggcaccgcgccgggtcaggcgtacttcatcaacgacgccgagccgatcaatatg
ttcgagttcgctcggcccgtggtcgaggcgtgcgggcaacgctggccgcgggtgcgaatt
tccggccctgcggtccactgggtaatgacgggctggcagcggctgcacttccggttcgga
ttccccgcgccgctgctcgagccgctggccgtcgaacgactgtacctggacaactacttt
tcgatcgctaaggcacgccgcgacctgggctatgagccgctgttcaccacccagcaggcg
ctgaccgaatgcctgccgtactacgtgagtctgtttgagcagatgaagaacgaggcccgg
gcggaaaaaacggccgccacagtcaagccgtag

DBGET integrated database retrieval system