KEGG   Mycobacterium canettii CIPT 140070017: BN45_30570Help
Entry
BN45_30570        CDS       T02422                                 

Gene name
echA
Definition
(GenBank) Putative enoyl-Coa hydratase EchA12 (enoyl hydrase) (unsaturated acyl-CoA hydratase) (crotonase)
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
mcz  Mycobacterium canettii CIPT 140070017
Pathway
mcz00071  Fatty acid degradation
mcz00280  Valine, leucine and isoleucine degradation
mcz00281  Geraniol degradation
mcz00310  Lysine degradation
mcz00360  Phenylalanine metabolism
mcz00362  Benzoate degradation
mcz00380  Tryptophan metabolism
mcz00410  beta-Alanine metabolism
mcz00627  Aminobenzoate degradation
mcz00640  Propanoate metabolism
mcz00650  Butanoate metabolism
mcz00903  Limonene and pinene degradation
mcz00930  Caprolactam degradation
mcz01100  Metabolic pathways
mcz01110  Biosynthesis of secondary metabolites
mcz01120  Microbial metabolism in diverse environments
mcz01130  Biosynthesis of antibiotics
mcz01212  Fatty acid metabolism
Module
mcz_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:mcz00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    BN45_30570 (echA)
   00650 Butanoate metabolism
    BN45_30570 (echA)
  Lipid metabolism
   00071 Fatty acid degradation
    BN45_30570 (echA)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BN45_30570 (echA)
   00310 Lysine degradation
    BN45_30570 (echA)
   00360 Phenylalanine metabolism
    BN45_30570 (echA)
   00380 Tryptophan metabolism
    BN45_30570 (echA)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BN45_30570 (echA)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    BN45_30570 (echA)
   00281 Geraniol degradation
    BN45_30570 (echA)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BN45_30570 (echA)
   00627 Aminobenzoate degradation
    BN45_30570 (echA)
   00930 Caprolactam degradation
    BN45_30570 (echA)
Enzymes [BR:mcz01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     BN45_30570 (echA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: CCK63614
Position
1723785..1724642
Genome map
AA seq 285 aa AA seqDB search
MPRRCAAQVAGGYRSTVSLVLVEHPRPEIAQITLNRPERMNSMAFDVMVPLKEALEQVNC
DNSVRVVVLTGAGRGFSSGADHKSAGVVPHVEDLTRPTYALRSMELLDDVILMLRRLHQP
VIAAVNGPAIGGGLCLALAADIRVASSSAYFRAAGINNGLTASELGLSYLLPRAIGSSRA
FEIMLTGRDVSAEEAERIGLVSRQVPDEQLLDACYAIAARMAAFSRPGIELTKRTLWSGL
DAASLEAHMQAEGLGQLFVRLLTANFEEAVAARAEQRAPVFTDDT
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
gtgccccgccgctgcgcggcgcaagtcgccggcgggtaccgttcaacggtgagtttggtc
ctcgtcgaacacccgcggcccgagattgcgcagatcaccctcaaccggccggagcggatg
aactccatggcattcgatgtcatggtgccgctcaaagaggcccttgagcaggtcaattgt
gacaactcggtgcgggtggtggtgctgaccggcgcgggtcgagggttttcttcgggtgcg
gatcacaagtcggcgggggtggtgccgcacgtcgaggacttgactcggccgacctacgcg
ctgcgctctatggagctcctcgatgacgtcattttaatgctgcgacggctgcaccagccg
gtgatcgccgcggtcaacgggccggccatcggtggtgggctgtgcctggcactcgccgca
gacattcgggtggcctcgagtagcgcctacttccgggccgccggtatcaacaacgggctg
accgccagcgaactggggttgagctacctgttgcccagggccatcggatcctcacgtgcg
ttcgagatcatgctgaccggccgcgacgtcagcgccgaggaagccgagaggatcgggctg
gtatcccgtcaggtacccgatgaacagctgctagatgcctgctacgcgatcgccgcacgg
atggcggcattctcgcggccgggaattgagttgaccaaacgtacgctgtggagtggactg
gacgccgccagtctggaggcgcacatgcaggccgagggcttggggcagctcttcgtccgg
ctgctcaccgccaacttcgaagaagcggttgccgcccgcgccgagcaacgggcgccggtg
ttcaccgatgacacgtaa

DBGET integrated database retrieval system