KEGG   Mycobacterium canettii CIPT 140070017: BN45_40048Help
Entry
BN45_40048        CDS       T02422                                 

Gene name
bioF
Definition
(GenBank) 8-amino-7-oxononanoate synthase BioF1 (AONS) (8-amino-7-ketopelargonate synthase) (7-keto-8-amino-pelargonic acid synthetase) (7-KAP synthetase) (L-alanine--pimelyl CoA ligase)
  KO
K00652  8-amino-7-oxononanoate synthase [EC:2.3.1.47]
Organism
mcz  Mycobacterium canettii CIPT 140070017
Pathway
mcz00780  Biotin metabolism
mcz01100  Metabolic pathways
Module
mcz_M00123  Biotin biosynthesis, pimeloyl-ACP/CoA => biotin
Brite
KEGG Orthology (KO) [BR:mcz00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    BN45_40048 (bioF)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:mcz01007]
    BN45_40048 (bioF)
Enzymes [BR:mcz01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.47  8-amino-7-oxononanoate synthase
     BN45_40048 (bioF)
Amino acid related enzymes [BR:mcz01007]
 Aminotransferase (transaminase)
  Class II
   BN45_40048 (bioF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 Aminotran_5 DegT_DnrJ_EryC1 Cys_Met_Meta_PP Aminotran_3 Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: CCK63717
Position
1846003..1847160
Genome map
AA seq 385 aa AA seqDB search
MKAATQARIDDSPLAWLDAVQRQRREAGLRRCLRPRPAVATELDLASNDYLGLSRHPAVI
DGGVQALRIWGAGATGSRLVTGDTELHQQFEAELAEFVGAAAGLLFSSGYTANMGAVVGL
SGPGSLLVSDARSHASLVDACRLSRARVVVTPHRDVNAVDVALRSRDEQRAVVVTDSVFS
ADGSLAPVRELLEVCRRHRALLLVDEAHGLGVRGGGRGLLYELGLAGAPDVVMTTTLSKA
LGSQGGVVLGPTPVRAHLIDAARPFIFDTGLAPAAVGAALAALRVLRAEPWRPDVVLKHA
RELARICGVGAPDSAMVSVILGEPESAVAAAAACLDAGVKVGCFRPPTVPAGTSRLRLTA
RASLNAGELELARRVLTDVLAVAHR
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atgaaagccgccacgcaggcacggatcgacgattcaccgttggcctggttggacgcggtg
cagcggcagcgccgcgaggccggactgcggcgctgcctgcggccgcgtcccgcggtcgcc
accgagctggacttggcctccaacgactatctcggtctgtcccgacatcccgccgtcatc
gacggtggcgtccaggcgctgcggatctggggcgccggtgccaccgggtcgcgcctggtc
accggcgataccgagctgcaccagcaattcgaggccgagctcgccgagttcgtcggcgct
gccgcgggattgctgttctcctcgggctacacggccaacatgggcgccgtggtcggcctg
tccggcccggggtctctgctggtgtccgacgcccgttcgcacgcgtcgttggtggatgcc
tgccggctgtcgcgggcgcgggtcgtggtgacgccgcaccgcgacgtcaacgccgtggac
gtcgcgctgcgatcgcgcgacgagcagcgcgccgtcgtcgtcaccgactcggtgttcagc
gccgacggctcgctggcgccggttcgggagttgcttgaggtctgccggcgtcatcgtgcg
ctgcttctggtggacgaggcgcacggcctgggtgtgcgtggcggcggacgcgggctgctc
tacgagttaggtctagcgggtgcgcccgacgtggtgatgaccaccacgctgtccaaggcg
ctcggcagccagggtggtgtggtgctcgggccgacgccggtgcgggcccatctgatcgat
gccgcccggccgttcatcttcgacaccggtctggcgccggcggcggtgggtgccgcgctg
gccgcgctgcgcgtcttgcgggccgagccgtggcggcccgacgtggtgctgaagcatgcc
cgcgaactggcccggatctgtggggtcggcgcgcccgactcggcgatggtgtcggtgatc
ctgggcgagccggagtcggcagtggccgccgcggcggcctgcctggacgccggggtcaag
gtgggctgcttccggccgccgactgtgcccgcggggacatcgcggctgcggctgaccgcg
cgcgcatcgctgaacgccggcgagctcgagctggcccggcgggtgctgacggatgttctc
gccgtggcgcaccgttga

DBGET integrated database retrieval system