KEGG   Mycobacterium canettii CIPT 140070017: BN45_50132Help
Entry
BN45_50132        CDS       T02422                                 

Definition
(GenBank) Putative Acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
mcz  Mycobacterium canettii CIPT 140070017
Pathway
mcz00071  Fatty acid degradation
mcz00072  Synthesis and degradation of ketone bodies
mcz00280  Valine, leucine and isoleucine degradation
mcz00310  Lysine degradation
mcz00362  Benzoate degradation
mcz00380  Tryptophan metabolism
mcz00620  Pyruvate metabolism
mcz00630  Glyoxylate and dicarboxylate metabolism
mcz00640  Propanoate metabolism
mcz00650  Butanoate metabolism
mcz00900  Terpenoid backbone biosynthesis
mcz01100  Metabolic pathways
mcz01110  Biosynthesis of secondary metabolites
mcz01120  Microbial metabolism in diverse environments
mcz01130  Biosynthesis of antibiotics
mcz01200  Carbon metabolism
mcz01212  Fatty acid metabolism
mcz02020  Two-component system
Brite
KEGG Orthology (KO) [BR:mcz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BN45_50132
   00630 Glyoxylate and dicarboxylate metabolism
    BN45_50132
   00640 Propanoate metabolism
    BN45_50132
   00650 Butanoate metabolism
    BN45_50132
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BN45_50132
   00072 Synthesis and degradation of ketone bodies
    BN45_50132
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BN45_50132
   00310 Lysine degradation
    BN45_50132
   00380 Tryptophan metabolism
    BN45_50132
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BN45_50132
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BN45_50132
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BN45_50132
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mcz04147]
    BN45_50132
Enzymes [BR:mcz01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BN45_50132
Exosome [BR:mcz04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BN45_50132
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_C
Motif
Other DBs
NCBI-ProteinID: CCK64004
Position
2193292..2194776
Genome map
AA seq 494 aa AA seqDB search
MPVDPRTPVLIGYGQVNHRDDIDAEKQSIEPVDLMAAAARKAADSTVLEAVDSIRVVHML
SAHYRNPGQLLGERIKARTFTTGYSGVGGNMPQSLVNRACLDIQRGRAGVVLLAGAETWR
TRTGLRAKGSKLEWTVQDESVPLPDMAGDDVPMAGAAELRINLDRPAYVYPIFEQALRIA
YGESIENHRKRIGELWARFSAVAADNPHAWIRNPVTADEIWQPGPQNRMVSWPYTKLMNS
NNMVDQGAALLLTSVERAARLRIPAERWVYPQAGTDAHDTPAVADRHRLHRSTAIRIAGA
RALELAGLGLDDIEYVDLYSCFPSAVQVAAIELGLDTDDPARPLTVTGGLTFAGGPWSNY
VTHSIATMAELLAANPGRRGLITANGGYLTKHSFGVYGTEPPSQFRWEDMQPAVDREPTG
DGLVEWEGIGTVEAWTTPVNRDGQPEKAFLAVRTPDGSRSLAVITDPASVQATVREDIAG
VKVAVAPDGTATLR
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgccggtagaccccaggacgccagtgctgatcggctatggacaggtcaaccaccgagac
gacatcgacgccgagaagcagtccatcgaacccgtcgacctgatggccgccgcggcccgg
aaagccgcggattcgacggtgctcgaggcggtggattcgatccgtgtggtgcacatgctg
tcggcgcattaccggaatcccgggcagctcctcggcgaacgaatcaaggcgaggaccttc
accaccggttacagcggggtgggcggcaacatgccgcaatccctggtcaaccgggcatgc
ctggacatccagcgcgggcgggccggcgtggtgctgctggctggcgccgaaacctggcgc
acccgaacgggcctgcgcgccaagggcagcaaactggaatggactgttcaggacgaatcc
gttccgctgccggacatggccggcgacgacgttccgatggccggtgcggctgagctgcgg
atcaacctggaccggccggcctacgtgtacccgatattcgagcaggcgctgcgcatcgcc
tacggcgagtcgatcgagaaccaccgaaagcggatcggcgagctgtgggcgcggttcagt
gccgtagctgccgacaacccgcacgcgtggatccgcaacccggttacggctgacgagatc
tggcagcccggcccacagaaccggatggtcagctggccctacaccaagcttatgaactcc
aacaacatggttgaccagggtgccgcgctgctgctgacgtcggtcgaacgtgcggcacgt
ctgcgaataccggccgaacgctgggtttatccacaggctggcaccgacgcccacgacaca
ccggccgtcgccgaccgccaccgactgcatcggtcgacggccattcggatcgccggtgcc
cgggcgctggaactggctgggctggggctcgatgacatcgaatacgtcgacctgtattcg
tgctttccctccgctgtccaagtcgccgcaatcgaactcggcctggacaccgacgatcct
gcccgcccgctgaccgtcaccgggggcctgaccttcgccggcgggccgtggagcaattac
gtcacgcactccatcgccaccatggctgaactgctcgcggccaatcccgggcgccgaggt
ctgatcaccgccaacggcggttacctgaccaaacacagtttcggggtctacggcaccgag
ccgccgtcgcaattccgctgggaggacatgcaacccgcggtcgatagggagcccaccggc
gatgggttggtcgagtgggaaggcatcggcaccgtcgaagcgtggaccacaccagtcaac
cgggacggacaacccgagaaggcgttcctggcggtgcgcacgcccgacgggtcgcgcagc
ttggccgtgatcaccgatcccgcatcggtgcaagcaacggtgcgcgaggacatcgccggc
gtcaaggttgccgtcgcccccgacggtaccgcgaccctgcgatag

DBGET integrated database retrieval system