KEGG   Mycobacterium canettii CIPT 140070017: BN45_50714Help
Entry
BN45_50714        CDS       T02422                                 

Gene name
plcA
Definition
(GenBank) Putative membrane-associated phospholipase C 1 PlcA (MTP40 antigen)
  KO
K01114  phospholipase C [EC:3.1.4.3]
Organism
mcz  Mycobacterium canettii CIPT 140070017
Pathway
mcz00562  Inositol phosphate metabolism
mcz00564  Glycerophospholipid metabolism
mcz00565  Ether lipid metabolism
mcz01100  Metabolic pathways
mcz01110  Biosynthesis of secondary metabolites
mcz02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:mcz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    BN45_50714 (plcA)
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    BN45_50714 (plcA)
   00565 Ether lipid metabolism
    BN45_50714 (plcA)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    BN45_50714 (plcA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02042 Bacterial toxins [BR:mcz02042]
    BN45_50714 (plcA)
Enzymes [BR:mcz01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.3  phospholipase C
     BN45_50714 (plcA)
Bacterial toxins [BR:mcz02042]
 Type II toxins: Membrane damaging toxins
  Toxins that enzymatically damage the membrane
   BN45_50714 (plcA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Phosphoesterase
Motif
Other DBs
NCBI-ProteinID: CCK64534
Position
complement(2734377..2735915)
Genome map
AA seq 512 aa AA seqDB search
MSRREFLTKLTGAGAAAFLMDWAAPVIEKAYGAGPCPGHLTDIEHIVLLMQENRSFDHYF
GTLSSTNGFNAASPAFQQMGWNPMTQALDPAGVTIPFRLDTTRGPFLDGECVNDPEHQWV
GMHLAWNGGANDNWLPAQATTRAGPYVPLTMGYYTRQDIPIHYLLADTFTICDGYHCSLL
TGTLPNRLYWLSANIDPAGTDGGPQLVEPGFLPLQQFSWRIMPENLEDAGVSWKVYQNKG
LGRFINTPISNNGLVQAFRQAADPRSNLARYGIAPTYPGDFAADVRANRLPKVSWLVPNI
LQSEHPALPVALGAVSMVTALRILLSNPAVWEKTALIVSYDENGGFFDHVTPPTAPPGTP
GEFVTVPNIDAVPGSGGIRGPLGLGFRVPCIVISPYSRGPLMVSDTFDHTSQLKLIRARF
GVPVPNMTAWRDGVVGDMTSAFNFATPPNSTRPNLSHPLLGALPKLPQCIPNVVLGTTDG
ALPSIPYRVPYPQVMPTQETTPVRGTPSGLCS
NT seq 1539 nt NT seq  +upstreamnt  +downstreamnt
atgtcacgtcgagagtttttgacaaagctcactggcgcaggcgcagcggcattcctgatg
gactgggctgcaccggtgattgaaaaggcctacggcgccgggccttgtcccggacatttg
accgacatcgagcatatcgtgttgctgatgcaggagaaccggtcattcgaccactatttc
ggaacgctttccagcaccaatgggttcaacgccgcgtcgccggcattccaacaaatgggt
tggaaccccatgacgcaggcgttggaccccgccggggtcaccattccgttccgcttggac
accacccgaggccccttcctggacggcgagtgcgtcaacgaccccgagcaccagtgggtg
gggatgcacctggcctggaacggtggtgccaacgacaactggctgccggcgcaggcgacc
acccgcgcaggaccctatgtccctttgaccatgggttactacacgcgccaagacatcccg
atccactatctgctggccgacacgttcaccatctgcgacggctaccattgctcgctactg
acgggcaccctgcccaaccggctctactggttgagcgccaacatcgaccccgccggcacc
gacgggggaccccaattggtagagccgggcttcctgccgctgcagcaattcagttggcgc
atcatgccggaaaacctcgaagatgccggggtcagctggaaggtgtaccagaacaagggc
ctcgggcgattcatcaacacgcccatcagcaataacgggctggtgcaggccttccgccag
gcagctgatccgaggtcgaacttggcccgctacggtatcgccccgacctaccctggggac
ttcgctgccgacgtcagggccaaccggctacccaaggtctcctggttagttcccaacatc
ctgcagtccgaacaccccgccctgccggtagcgcttggcgcggtgtccatggtgaccgcg
ctgcggatcttgctgtccaatcccgcggtgtgggaaaagaccgcacttatcgtcagctat
gacgagaacggcggcttcttcgaccacgtcacgccccccacggcaccgcccgggacaccc
ggcgaattcgtcacggtgcccaacatcgacgcagtacccgggtccggtggcatccgtggt
ccgctcggtctgggttttcgcgtgccctgcattgtcatttcgccgtacagccgcggcccg
ctgatggtctccgacacgttcgaccacacctcgcaattgaagttgattcgcgcccggttc
ggcgtgccggttcccaacatgaccgcctggcgcgacggcgtggttggcgacatgacctca
gcgttcaactttgcgactccaccgaattcgaccagacccaacttgagccacccgttgctg
ggagcgctgccgaagctgccgcagtgcatccctaacgtggtgttgggaaccaccgacggc
gcgttgccgagcattccctatcgggtgccctatccgcaggtgatgccaactcaggaaacc
acacccgtccgcgggactcccagcgggctgtgcagctga

DBGET integrated database retrieval system