KEGG   Musca domestica (house fly): 101888752Help
Entry
101888752         CDS       T03448                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: tankyrase
  KO
K10799  tankyrase [EC:2.4.2.30]
Organism
mde  Musca domestica (house fly)
Brite
KEGG Orthology (KO) [BR:mde00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:mde03032]
    101888752
   03036 Chromosome and associated proteins [BR:mde03036]
    101888752
Enzymes [BR:mde01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.30  NAD+ ADP-ribosyltransferase
     101888752
DNA replication proteins [BR:mde03032]
 Eukaryotic Type
  DNA Replication Termination Factors
   Other telomere regulation proteins
    Others
     101888752
Chromosome and associated proteins [BR:mde03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Pericentriolar materials (PCM)
    Other PCM proteins
     101888752
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ank_2 Ank_5 Ank_4 Ank Ank_3 PARP SAM_2 SAM_1 Amidohydro_1
Motif
Other DBs
NCBI-GeneID: 101888752
NCBI-ProteinID: XP_005178291
UniProt: A0A1I8NB60
Position
Unknown
AA seq 1580 aa AA seqDB search
MTSRSRAINVNLDAVINDPLRELFEACKTGEIGKVKKLITSQTVNARDTAGRKSTPLHFA
AGYGRREVVEFLLNNGASIQACDEGGLHPLHNACSFGHAEVVRMLLKAGACPNTTDNWNY
TPLHEAASKGKVDVCIALLQHGANPNIRNSENKTPLELADENTRPVLTGEYRKDELLEAA
RSGAKERLLALLTPLNVNCHASDGRRSTPLHLAAGYNRIGIVEILLAHGADVHAKDKGGL
VPLHNACSYGHFEVTKLLIKAGADVNANDLWAFTPLHEAASKSRVEVCSLLLSKGANPTL
LNCHNKSAIDSAPTRELRERIHYEYKGHCVLDACKTGNIPRLKKFLSSETVNFVHPYTGD
TPLHATAVSIDPKRKQISELLIRKGALLNEKNKAFLTPLHVAAEQLHYDIMDTLLKNGAK
VSAVDGLGQTALHKCARDEQAVRLLLSYNIDTSIISVEGYTAAQLASDSVLKILKDPPDT
ETHLLEAAKAGDLDTVRRIVLANPHSVNCRDLDGRHSTPLHFAAGFNRVQVVEFLLEQGA
EVHAADKGGLVPLHNACSYGHFEVTKLLIKAGANVNVSDLWKFTPLHEAAAKGKYDIVKL
LLKHGADPTKKNRDGATPADLVKESDHDVAELLRGNSALLDAAKKGNLARVQRLVTPETI
NCRDAQGRNSTPLHLAAGYNNYEVAEYLLENGADVNAQDKGGLIPLHNASSYGHLEIAAL
LIKHKTVVNATDKWGFTPLHEAAQKGRTQLCSLLLAHGADPYMKNQEGQTPIELATADDV
KCLLQDAMATSLSSSALSASQQSLLSNNSTPLASAAAAGAATTATSATANSLSATNGSSV
AACTVLSPSTETVTLPSGASMTLSVPVPLPLSTRISPAQGAEANSTDLGEDVADPESITN
IASFLSSLQLEHLTDLFEREQITLEILAEMGHEDLKQVGVSAYGFRHKILKGIAQLRATT
GIGNNVNPGTLLVDLLPDDKEFLAVEEEMQATIREHRDNGQAGGYFTRYNIIRVQKVQNR
KLWERYAHRRQEVSEENTMQANERMLFHGSPFINAIVQKGFDERHAYIGGMFGAGIYFAE
HSSKSNQYVYGIGGGIGCPSHKDKSCYMCPRQLLLCRVALGKSFLQYSAMKMAHAPPGHH
SVIGRPSAGGLHFAEYVVYRGEQAYPEYLITYKIVKPEDSSSGAEETRXWMPSVGSTPTT
SSPALQQQQSLQSSMAPAQHSSNAVHLPPQNSSSISLQQQHAKIQQQHSLPLQLQYQVTT
TQPSPAGMFISQTAGIISSTAALGNTASFFNAATSGADLSPTSSTASFSSVDTNQTLLNS
IAANQQQQQQQQQQSSQSSGSNQHHHLSSLGQKNSYSSSSGGHGNGSTTSKAIVPSSNRS
YRTKYSQFMIITPAVSIDRDFDRTDTLSSNAADNHGFHTADDDPYPHNGNIFRFNNLQAS
IDSGNSSDSGSFRSNYNPYLHNSRQHLLPKSAPPFYNFSPSSWCNLICAAMRCFGAGGGG
GGGAGGSGRNRSGLYSTSFGRPPYQRSRSSGPHTSSKTPHRRLRSYSTSSFTPETAFEHF
SAPFKARKTRDEQNNIAYEL
NT seq 4743 nt NT seq  +upstreamnt  +downstreamnt
atgaccagccgcagtcgagctataaatgttaacctggatgcggtcatcaatgatccattg
cgtgagctgttcgaagcctgcaaaacgggtgaaattggcaaagttaagaagctgataaca
tcgcagacagttaatgctcgtgatacggctggaaggaaatcgacaccgctacactttgca
gcaggttacggtcgccgagaggttgttgaattcctactcaacaatggtgcttccatacag
gcctgcgacgagggtggcctccatcctctacacaatgcctgttcctttggtcatgccgaa
gtggtacgcatgctgctgaaggccggtgcctgtcccaatacgacagataactggaactac
acaccgctgcacgaggcggccagcaagggcaaagtcgatgtctgcattgccctgctgcag
cacggtgccaatccgaatattcgtaattcggagaataaaactcccctggaattggccgac
gagaatacacgacccgtcctcaccggcgagtatcgtaaggatgaacttttagaggcggct
cgatcgggggccaaggaacgtctgttggccctgctgacaccactcaatgttaattgtcat
gctagcgatggtagacgttcaacacctttacatttagcagcgggttacaatcggatagga
attgtcgaaattctgctggcacatggagcggatgtgcatgctaaagataaaggtggtttg
gtgccattacacaatgcctgttcgtatggtcacttcgaggtgaccaaactactgatcaag
gccggtgctgatgtcaatgccaatgatttgtgggcatttacgccgttgcacgaagctgcc
tctaagagtcgtgtcgaagtgtgtagtctgctcctgagcaagggggcgaatccgacgctg
ctcaattgtcacaataagtcggcaattgattcggcaccaacgagggaattgcgtgagcgt
attcactatgaatacaagggccattgtgtcttggatgcttgcaaaacgggcaatataccc
aggctaaagaaattcctttcatcggaaacggtcaactttgtacatccttatacgggggac
acgcctttgcatgccacagcagtgtccattgatcccaaaaggaaacagatctccgaatta
cttatacgcaaaggcgcactgctaaacgaaaagaataaagcctttctcacacccctgcat
gtggctgccgaacaattgcactacgacattatggatactctgttgaaaaatggtgccaaa
gtcagtgctgtcgatggattgggacagacggcgctgcataaatgcgctcgtgacgaacag
gccgtacgtttgctactctcctataatattgacacctccatcatatcggtggaggggtac
acggccgcccaactagcctcagatagtgttttgaaaattctcaaagatccaccagacact
gaaacacatctgctggaagctgccaaggctggagatttggatacagtgcggcgcatcgta
ttggccaatccacattcggtgaattgtcgtgacctagacgggagacattcgacacctttg
cattttgccgcaggctttaatcgggtgcaagttgtggagttcctgttggaacagggagcc
gaggtgcatgccgccgacaagggtggtctggtgccgctgcacaatgcctgttcatatggg
cattttgaggtaacaaaattgcttataaaagccggtgccaatgtcaatgtttcggatctg
tggaaattcacaccgctccatgaagctgccgccaagggaaaatatgacatcgtaaaactg
cttctcaaacacggtgcagatcccacaaaaaagaatcgtgatggtgccacacctgctgat
ttagtcaaagaatccgatcatgatgtggccgaattgcttaggggtaactcggcccttttg
gatgccgccaagaaaggaaatctggcacgagtccaaaggctggttacccccgaaaccatc
aactgtcgcgatgctcaaggccgcaactccacacccttgcatttggctgccggctacaac
aactacgaagtggcggaataccttttggagaatggggccgatgtcaatgcccaggacaag
ggtggcctaatacctctgcacaatgcatcctcgtatggccatctggaaattgcggcgctc
ctcatcaaacacaagactgtggtaaatgctaccgacaaatggggtttcacacccctgcat
gaagcagcccaaaagggtcgcacacaactctgttcgttgttgttggcccacggtgctgat
ccctatatgaagaatcaagaaggccaaactcccatagaattagccacagctgatgatgtg
aaatgtttgctgcaagatgccatggccacatcgttgagtagctcagcattaagtgcttcc
caacaatcattgctgagcaacaactcaaccccattggcatcggcggcagcggcgggtgca
gcaacaaccgcaacatcagctaccgccaacagtttatcggccacaaatggcagcagtgtc
gccgcctgtacagtgctttcgcccagcactgagaccgtaaccctgccttcgggtgcctca
atgaccctaagtgttcctgtgcctctacccttgtcgacacgcatcagtccagctcagggt
gccgaagccaattccacagatttgggtgaagatgttgcggatcccgagtccataacaaac
attgccagtttcttgagcagtttacaattggaacatttaacggatctcttcgaaagggaa
caaataacgctggaaatattggccgaaatgggtcatgaagatttgaaacaggttggagtg
tcggcgtatggttttcgccataagatacttaagggcatagctcaactgagggctaccacg
ggtattggcaacaatgtcaatcctggcacattgctagttgatcttttacccgatgataaa
gaatttctagcagtggaggaggaaatgcaggccaccatcagagagcacagggacaatggt
caagctggtggttattttacccgttataacattatacgagttcaaaaggtacaaaatcgt
aaactgtgggaacgatatgcccatcgtcgccaagaagtttccgaggagaatacaatgcag
gccaatgaacgaatgctcttccatggtagccccttcatcaatgccattgttcagaagggt
tttgatgaacgacatgcctacattggtggtatgtttggtgctggcatttattttgccgaa
cacagttcgaaaagtaatcaatatgtgtatggtattggtggaggtattggatgtccatcg
cacaaagataaatcgtgttatatgtgtccaagacaactgcttttgtgtcgagtggctctg
ggtaaatcttttctgcaatatagtgccatgaaaatggcccatgcaccgccgggtcatcat
tccgttattggccggccctcggcgggtggcctgcactttgccgaatatgtggtgtacaga
ggtgaacaggcctatcccgaatatctaattacctataaaattgtcaaacccgaggacagt
agtagcggggccgaggaaacaagatgatggatgccctctgtcggttctacaccaactaca
tcatcgccagccctgcaacagcaacagtcattacaatcttctatggctccagcacagcac
tccagcaatgccgtgcacttgccaccgcaaaattcctctagcatttccctgcaacagcaa
catgccaaaatccagcagcaacactcactgccattgcagttacaataccaggtgacgaca
acgcaaccttcgccggctggcatgttcattagccagacggctgggattattagcagcacg
gccgccttgggtaatacggcgtcgtttttcaatgcagccacatccggggcggatctatcg
cccacatcatcgacagcctcgttttcatcggtggatacaaatcaaactttgctaaattcc
attgcagccaatcaacagcagcaacaacaacagcagcagcaatcgtctcagagctcaggc
tcaaatcaacatcaccacctatcctcattgggtcagaaaaattcctattcttcatcttcc
ggaggacatggcaatggttcgacgacctcaaaggccattgtgccctcctcgaatcgttct
tatcgcaccaaatacagtcaatttatgattatcaccccagccgtgtccatagatagggat
tttgatcgcaccgacaccctgtcatcgaatgcggccgataatcatggcttccacacagcc
gacgatgatccctatccccacaatggcaatatatttcgcttcaacaatctgcaggcaagc
attgacagcggcaacagcagtgacagtggttcatttcgttcgaattacaatccctatctg
cacaatagtcgccagcacctgttgcccaaatcggccccacctttttacaatttctcaccg
tcgtcatggtgtaatttgatttgtgcagccatgcgctgctttggggctggtggtggaggt
ggtggcggtgctgggggcagtggccggaatcgtagtggcctgtatagcacctcctttgga
cggccaccctatcaaaggtctcgcagttcgggaccgcacacctcgtcgaagacgccgcat
cgtcgtttgcgttcgtattccacttcatcgtttacacccgaaactgcctttgagcatttc
tctgcaccgtttaaggcgcgcaagacgcgtgacgaacagaacaacattgcctatgagttg
tga

DBGET integrated database retrieval system