KEGG   Musca domestica (house fly): 101888894Help
Entry
101888894         CDS       T03448                                 

Definition
(RefSeq) tyrosine-protein phosphatase vhp-1
  KO
K20216  dual specificity phosphatase 10 [EC:3.1.3.16 3.1.3.48]
Organism
mde  Musca domestica (house fly)
Pathway
mde04013  MAPK signaling pathway - fly
mde04214  Apoptosis - fly
Brite
KEGG Orthology (KO) [BR:mde00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04013 MAPK signaling pathway - fly
    101888894
 09140 Cellular Processes
  09143 Cell growth and death
   04214 Apoptosis - fly
    101888894
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mde01009]
    101888894
Enzymes [BR:mde01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     101888894
    3.1.3.48  protein-tyrosine-phosphatase
     101888894
Protein phosphatases and associated proteins [BR:mde01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   MAPK phosphatases
    101888894
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DSPc Y_phosphatase PTPlike_phytase Init_tRNA_PT
Motif
Other DBs
NCBI-GeneID: 101888894
NCBI-ProteinID: XP_005185714
UniProt: T1PJX3
Position
Unknown
AA seq 399 aa AA seqDB search
MKMRMKRESPCLLLRFMPITKVEYGNKRPKDNLDTPCSEEETNSSSSRPSLTRSCSSPAV
YDIETHPASHVFPHLLLGNGRDAGDPSSVGANCVLNVTCQAPSTNPMPGLKYMQIPASDT
PHQNIKQYFQEAYDFIEDARKTGSKVLLHCHAGISRSATIAIAYVMRYKSLSLLEAYKLV
KGVRPIISPNLNFMGQLLELEQSLRLSGVLEPISPAPLPATPTSSQNGDDKQPTTPTTIV
TPTKCDDDIQTMDLDECDSGHSSGGSSNCSSRLTSPPITPEDETLGTSTSAAALATASST
LTLSSTSTSALSLCTSPPAAVSTNHLSATRPSRFKRNSPAKLRLNLQSTYAPIPKSLSCM
TIHSAGISPICKDAPATPSCEMTMGFSNNNSNSSSSRAD
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatgcggatgaaaagagaatcaccgtgcctacttctaagatttatgccaatcacc
aaagtcgaatacggtaataagagaccgaaagataacctggataccccttgcagtgaagaa
gaaacaaactcctcgtccagtcggccatcgctgacgaggagttgtagtagtccagcagta
tatgatatcgaaacacatcccgcctcacacgttttcccacatctattgctgggcaatggc
cgtgatgctggcgatcccagtagtgtgggagcaaattgtgttttaaatgttacctgccaa
gcaccgagcacaaatccaatgccgggccttaaatatatgcaaatacctgccagtgataca
cctcatcaaaatattaaacaatattttcaggaagcctacgattttattgaagatgcccgt
aaaactggctccaaagttttactacattgccatgcgggaatatctcgcagtgccacaatt
gccattgcctatgttatgcgttataaatccctttcactgttggaggcctataaattggtg
aaaggggtccggcctattatatcgcccaatttaaatttcatgggacaattattggaactg
gagcaaagtttaaggttgagtggtgtattggaacccatatcgcccgcacccttaccagcc
acaccaacatctagtcaaaatggcgacgacaaacaaccaacaactccaacgacaattgtg
acaccaacaaaatgcgatgatgacattcaaacaatggatttggatgagtgtgatagcggc
catagcagtggtggcagcagtaattgttcatcaaggcttacctcaccgcccataacaccc
gaagatgaaacacttggcacctcaacatcagccgctgccttggcaacagcatcatccaca
ttgactttgtcgtcgacatcgacatcggcattatcattatgcacttccccgccagccgca
gtgtctacaaatcatttaagcgccacccgcccttcacgttttaaacgcaactcacccgca
aaactaaggcttaacttacagtcaacctatgctcccatacccaagtccttatcctgcatg
acaatacacagtgctggaataagccccatatgtaaagatgcaccagcgacaccttcatgt
gaaatgaccatgggctttagtaacaacaacagtaatagtagcagcagtcgcgctgattga

DBGET integrated database retrieval system