KEGG   Musca domestica (house fly): 101889026Help
Entry
101889026         CDS       T03448                                 

Definition
(RefSeq) aldehyde dehydrogenase X, mitochondrial
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
mde  Musca domestica (house fly)
Pathway
mde00010  Glycolysis / Gluconeogenesis
mde00053  Ascorbate and aldarate metabolism
mde00071  Fatty acid degradation
mde00280  Valine, leucine and isoleucine degradation
mde00310  Lysine degradation
mde00330  Arginine and proline metabolism
mde00340  Histidine metabolism
mde00380  Tryptophan metabolism
mde00410  beta-Alanine metabolism
mde00561  Glycerolipid metabolism
mde00620  Pyruvate metabolism
mde00981  Insect hormone biosynthesis
mde01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mde00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    101889026
   00053 Ascorbate and aldarate metabolism
    101889026
   00620 Pyruvate metabolism
    101889026
  09103 Lipid metabolism
   00071 Fatty acid degradation
    101889026
   00561 Glycerolipid metabolism
    101889026
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    101889026
   00310 Lysine degradation
    101889026
   00330 Arginine and proline metabolism
    101889026
   00340 Histidine metabolism
    101889026
   00380 Tryptophan metabolism
    101889026
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    101889026
  09109 Metabolism of terpenoids and polyketides
   00981 Insect hormone biosynthesis
    101889026
Enzymes [BR:mde01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     101889026
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-GeneID: 101889026
NCBI-ProteinID: XP_005189874
UniProt: A0A1I8M596
Position
Unknown
AA seq 485 aa AA seqDB search
MANPHEEPKYTKLFINNEFVDAKSGKTFPTVNPATGKVIVEVAEGDKADVDLAVAAAKKA
FHRNSEWRKMAPLKRTELMLRLCDLMERDKVFLANIETRDNGKPYAEALFDVEISIMTLK
YYAGWTDKFFGDTIPAGGFISMTRKEPIGVVGQIIPWNYPLLMLSWKWGPALAVGCTIVM
KPAEQTPLSALHMAALAKEAGFPAGVINVITGYGPTAGAAISEHPDIQKVAFTGSVDVGR
IVMEAAAKSNLKRVSLELGGKSPVVVFDDADIDLAVDITFEALFANHGQSCCAGSRTYVH
EKIYDQFVAKTVAKAKARKVGDPFDSTVAQGPQIDEEMMTKVLGYIESGKSDGAKLQCGG
KRIGDIGFFIEPTVFSDVTDNMKIAQEEIFGPVQSIFKFSNIEEMIDRANNVKYGLAAGI
ITNDINKAMYFANNVDAGSVWINCYDAVLPQTPFGGYKHSGIGRELGKDGLDNYLETKTI
TMKLV
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atggcaaatccacatgaagaacctaaatatacgaagctttttatcaacaatgaatttgtt
gatgccaagtccggcaagacttttccaactgtaaatccagctaccggtaaagttattgtc
gaagtcgccgagggtgataaggccgatgttgatttagcagttgctgctgccaaaaaggct
ttccataggaattcggaatggcgcaaaatggctcctttgaaacgtactgaattaatgcta
agactatgtgatttaatggaacgtgataaggtgttcctggccaacattgaaactcgcgat
aatggcaaaccttatgctgaagctttgttcgatgtagagatttcaattatgacattgaaa
tattatgccggttggactgacaaattctttggagataccattccagctggtggattcatt
tctatgacccgcaaggaaccaatcggtgttgttggacaaattattccatggaattatcca
cttttgatgttgtcatggaaatggggtccagcattggctgttggttgtacaattgttatg
aaacccgccgagcaaacaccattgtccgcactgcatatggctgccctggccaaggaggct
ggttttccagctggtgttataaacgttattaccggttatggtcccaccgcaggtgctgcc
atatctgaacatcctgacattcaaaaggtcgcatttactggctccgttgatgttggtcgc
attgttatggaagctgctgctaaatccaatcttaaacgtgtttccttggaattgggcggt
aaaagtccagtggtggtgttcgacgatgccgatattgatttggctgtggacataaccttt
gaagccttgtttgccaaccatggccaaagttgctgtgccggtagtcgcacctatgtccat
gaaaagatttacgatcaatttgttgccaagactgttgccaaagctaaagctcgtaaagta
ggtgatccttttgattcgactgttgcccaaggtccacaaattgacgaagagatgatgacc
aaagttttgggttatattgaaagtggcaaatccgatggtgccaagcttcagtgtggcggt
aaacgtatcggtgatattggtttctttattgaaccgacagttttttcggatgttactgat
aacatgaagattgcccaagaggaaatctttggcccagttcaatccattttcaaatttagc
aacattgaagagatgattgaccgtgctaataatgtcaaatatggcttggccgctggcatt
attaccaatgacattaacaaggcgatgtatttcgccaataatgttgatgccggctccgtt
tggataaattgctatgatgctgttttgccacaaacaccatttggcggttataaacactcc
ggcattggacgcgaattaggaaaagatggtttggataattatttggaaactaaaaccatt
accatgaaattggtataa

DBGET integrated database retrieval system