KEGG   Musca domestica (house fly): 101889816Help
Entry
101889816         CDS       T03448                                 

Definition
(RefSeq) estradiol 17-beta-dehydrogenase 8
  KO
K13370  17beta-estradiol 17-dehydrogenase / 3alpha(17beta)-hydroxysteroid dehydrogenase (NAD+) / 3-oxoacyl-[acyl-carrier protein] reductase alpha subunit [EC:1.1.1.62 1.1.1.239]
Organism
mde  Musca domestica (house fly)
Pathway
mde00061  Fatty acid biosynthesis
mde01100  Metabolic pathways
mde01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:mde00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    101889816
Enzymes [BR:mde01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.62  17beta-estradiol 17-dehydrogenase
     101889816
    1.1.1.239  3alpha(17beta)-hydroxysteroid dehydrogenase (NAD+)
     101889816
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: adh_short_C2 adh_short KR Epimerase 2-Hacid_dh_C RmlD_sub_bind F420_oxidored Sacchrp_dh_NADP ADH_zinc_N Shikimate_DH Methyltransf_11
Motif
Other DBs
NCBI-GeneID: 101889816
NCBI-ProteinID: XP_005184717
UniProt: A0A1I8N8R6
Position
Unknown
AA seq 248 aa AA seqDB search
MAQQLIGKLAIVTGAGSGIGRSTCRLLRDYGAKVIAADRNIKAAEETAKELGDRDIFPLE
VDVSSLQSVTNAVGKTYEQFQTTPSIVVNSAGITRDGYLLKMPERDYDDVYSVNLKGTFM
VTQQFAKAMIEHKIQGGSIVNISSIVAKMNNIGQANYAATKAGVISFTEVASKEFGKFGI
RVNAILPGYINTPMVAVVPEKIKEQVVMRCPLGRLGEPNEIAEVIAFLASDKSSYINGAA
IEVTGGLK
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atggcacaacaattaattggaaaattagccattgtaacaggtgctggaagtggtatcggt
cgcagcacttgtcgtctattaagagattatggggccaaagtcatagcagctgatcgtaac
ataaaggcggcagaggagacggcaaaagaattgggtgatcgtgacatattccccttggaa
gttgatgtctcatcactgcaaagtgtaaccaatgctgttggcaaaacctacgaacaattc
caaacaacgccatccattgttgtcaactcggcgggcatcacacgcgacggttaccttttg
aaaatgcccgaacgtgactacgacgatgtgtacagcgtcaatctgaaaggtacattcatg
gtaacacagcaattcgccaaagccatgattgaacataaaattcagggtggtagcattgtt
aacatttccagtattgttgccaaaatgaacaacatcggccaggctaattatgctgccaca
aaggctggcgtgatatcgtttacggaagtcgcttctaaggaattcggtaaatttggcatt
cgtgtcaatgccatacttcctggctacattaatacacctatggtcgctgttgtaccggaa
aaaattaaggaacaagttgtgatgcgttgtccattgggtcgcctgggagaaccgaatgaa
attgctgaagtcattgcatttttggcatcggacaaatcgtcgtatattaatggtgctgcc
attgaggtgactggtggtcttaagtga

DBGET integrated database retrieval system