KEGG   Musca domestica (house fly): 101890082Help
Entry
101890082         CDS       T03448                                 

Definition
(RefSeq) palmitoyltransferase Hip14
  KO
K20032  palmitoyltransferase ZDHHC13/17 [EC:2.3.1.225]
Organism
mde  Musca domestica (house fly)
Brite
KEGG Orthology (KO) [BR:mde00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mde04131]
    101890082
Enzymes [BR:mde01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.225  protein S-acyltransferase
     101890082
Membrane trafficking [BR:mde04131]
 SNARE
  SNARE associated proteins
   Palmitoyltransferases
    101890082
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHHC Ank_2 Ank_5 Ank_4 Ank Ank_3
Motif
Other DBs
NCBI-GeneID: 101890082
NCBI-ProteinID: XP_005180681
UniProt: T1PI12
Position
Unknown
AA seq 649 aa AA seqDB search
MYQSACNVATTGSCAPNAEAEREIERQNALMSQQPPTQPIEPDYKGEMATFDIVKATQYG
ATARVKELVEAGWDVNQRDSETVTLLHWAAINNRRDIIKYFLEKGAVVDALGGELNATPL
HWATRQGHLGAVVLLMAAGADPRIRDAEGCSCIHIAAQFAHTALVAYFIAKGVDPDLQDR
GGMTALMWAAWKVCALDPVRLLLTLGANPAMVDYTHGNTALHWAILARNSTAISTLVLKS
KASLDVPNLRGETPLSMLESQAGAVWIGGKVMERVRDASLTSQQRRSLITRVKHDKRLRW
WSMVACPFTAFYLAGVVFTLNTLYIIKFFLLVCLYAVFHTLGKTLFDDHLMALLPLSVYL
ATKAWFYITWFVYIIDAVSFGTTLLFLLCSGGLWYCFLKSWKGDPGIIQPTQEQRFKTII
ELSERGGVGFEPSSFCSGCLVRRPIRSKHCSVCDRCVARFDHHCPWVGNCIGLKNHTYFM
GFLWMLLVMCAWMIYGGSYYYMNTCNVHFDDLLAALRAIGDCNAWIGFVMANALLHMSWV
ILLTICQTYQVICLGMTTNERMNRGRYRHFQARSGKSPFTRGAFNNLIDFLECTCFGLFK
PKRIDWMNYYDFDVHTSKPIEHEPLLSNGGGGGGDDSTAVSASHNFQYV
NT seq 1950 nt NT seq  +upstreamnt  +downstreamnt
atgtatcaaagtgcttgtaatgtggccaccacgggctcgtgtgcacccaatgccgaggcg
gaacgcgagattgaacgtcaaaatgccttaatgtcacaacaaccacccacccaaccaatt
gagcccgactacaagggagaaatggccacatttgacatcgttaaagccacacagtacgga
gctacggcgagagtaaaagaactggtcgaggctggttgggatgtcaatcagcgggatagt
gaaacggtgaccctgttgcactgggctgccattaacaatcgtcgggatattatcaagtat
tttctggagaagggtgccgtggtcgatgccttgggtggtgaattgaatgccacccccttg
cattgggcaaccagacaaggtcatttgggtgctgtggtcttgctgatggcagccggagct
gatcctcggatacgtgatgccgaaggctgttcctgtatacacatagcagcccagtttgcc
cacacggccttggtggcatatttcatagcgaaaggtgttgatcctgatttacaggatcgt
ggtggcatgacagcccttatgtgggcggcttggaaggtgtgtgctttggatccggtgcga
ctgctactgaccctgggcgcaaatcctgccatggtcgattatacacacggcaatacggca
ttacattgggccatactggcacgcaattccacggccataagtactttagttttaaaatcc
aaggcttccttagatgtgcctaatctacgcggcgaaaccccactcagcatgctggaatca
caggcaggtgccgtgtggattggtggcaaagttatggagcgggtgcgtgatgcatcgctg
acctcacagcaacggcgcagcctgataacacgtgtgaaacatgataaacgtttgcgctgg
tggtcaatggttgcatgtccctttacggccttctatttggccggtgtggtctttacactg
aacaccttgtatattattaagttctttttgttggtatgcctgtatgcggtgtttcatacg
ttgggcaagacgctgttcgacgatcatctgatggccctgctgccgttgagtgtgtatttg
gccaccaaggcctggttctatattacctggtttgtgtatatcattgatgctgtgtcgttt
ggtaccacattgctgttcttgctgtgttccggtggcttgtggtattgctttttgaagtcg
tggaagggtgatccgggtattatacaaccaacacaggagcaacggtttaagaccattatt
gagttgtcggaacgtggcggtgtgggctttgaaccttcctccttttgttcgggctgtttg
gttagacgacccatacgctccaagcattgtagcgtgtgcgatcggtgtgtggcccgtttc
gatcatcattgcccctgggttggcaattgcataggcctgaagaatcacacctattttatg
ggtttcctgtggatgctgttggtcatgtgtgcatggatgatttatggcggatcttattac
tacatgaatacttgtaatgtgcattttgatgatctcttggcagctttgagggccattggg
gactgcaatgcctggattggttttgtcatggccaatgccttgctgcacatgtcctgggtc
atattgttgaccatttgccagacatatcaggtcatatgtctgggtatgaccacaaatgag
cgcatgaatcgtggtcgttatcggcatttccaggcacgcagtggtaaatcaccctttacc
cgcggagcctttaacaacctgattgatttccttgagtgcacctgttttgggttgttcaaa
cccaaacgcatcgactggatgaattactacgatttcgatgtacacaccagcaaacccata
gaacatgaaccattgttgagcaatggtggcggcggtggtggcgacgattcaacggcagtc
tcagcttcacataattttcagtatgtgtag

DBGET integrated database retrieval system