KEGG   Musca domestica (house fly): 101893723Help
Entry
101893723         CDS       T03448                                 

Definition
(RefSeq) titin isoform X2
  KO
K12567  titin [EC:2.7.11.1]
Organism
mde  Musca domestica (house fly)
Brite
KEGG Orthology (KO) [BR:mde00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mde01001]
    101893723
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mde04131]
    101893723
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mde04812]
    101893723
   04147 Exosome [BR:mde04147]
    101893723
Enzymes [BR:mde01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     101893723
Protein kinases [BR:mde01001]
 Serine/threonine kinases: CAMK group
  MLCK family
   101893723
Membrane trafficking [BR:mde04131]
 Others
  Actin-binding proteins
   Others
    101893723
Cytoskeleton proteins [BR:mde04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Others
     101893723
Exosome [BR:mde04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   101893723
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: I-set Ig_3 Ig_2 ig Titin_Ig-rpts V-set C1-set Ig_6 Receptor_2B4 V-set_CD47
Motif
Other DBs
NCBI-GeneID: 101893723
NCBI-ProteinID: XP_005190790
UniProt: A0A1I8N5F2
Position
Unknown
AA seq 4792 aa AA seqDB search
MQRQNPSNQQQLQQHQQQQQIMQQTQQTTMQSHQEMHQQQRISRTEHHVQRSQVTTHQRV
EQHGGSYVPPGITHIYSQGDISPPVFEEIFKNARFAQGGNALFEGKLRGNPKPFVTWTRK
GAPLLESQKFRMNYNEATGEVSLLINQIGPGDEGEYTCTARNQYGEAICSVYIQPEGAPP
IQPIQKFEKNLYTNGYAFTSVEEEFRVDTFEYRLLREVSFREAITRRATYEQDYHLSQEV
DRSMGPAHAPQIAQKPRNSKLVEGSDAVFTAKVGSNPKPRLTWFHNGQRLVQSAKYDISY
SSGTATMRIKKATHKDAGHYTLLAENTQGCVVSSAVLAVEPAAESAHEPKPVDTTAEQLE
AGKALPPTFVKAFMDREITEGRMTRFDCRVTGNPYPEVYWFINGRQVNDDATHKILVNES
GSHSLMITNVSRTDAGTVQCLARNKAGEIAIEAQLNVLEMEQVVAPQFVQRFSTMTVREG
EPITMSANAIGTPMPRITWQKDGVQITSTADRFIGIDGGATCLEIPRVKASDAGWYQCTA
QNAAGSTANRARLYVEVPREQPPTEQRRLNLPRPTKIIEPEPQPGPEVIYLRHVERAKPQ
RRPGEEERVYPPPQFIVPLQNVQQVEGSKVHMEARIEPVGDPTMVVEWFLNGRPMAASSR
ATSVFKFGFIALDLLSVMSHDSGEYLCRVTNASGVAESRAILSVTQRPSIEQTSQHPSSL
EYISNLEDYSRYQRQESTEEFMKQAPVFIRPLHDLGDLEEGKNAHFEAQVNPVNDPTMRV
EWYKDGRPITASSRITAIFNFGYVSLNILHLRAEDTGTYTVRAVNSMGEAVSNSNIRVNV
RSQVTADLGIPEQQRYIEKVEELEDYRMAQKRRHVHEVPEPIAPPQFKTQIQNQVDMREG
GHAHFEARLEPTGDSTMRIEWYKDGQPLEASSRSTTFFNFGYVALTIKQLTIYDAGTYTC
RAYNAMGEDITTAQLSVISKHEIVSDSQHPGGLEKIQHLEDSSRYGRSEEEEVTVKQAPR
FLGPMKGTNKIIEGQKAHFEARVEPQSDLTMSIEWYHNGQPISAATRIQPYYDFGYVALD
ITQVRAEDAGVYTVVARNKLGEAQLQGTMVVETRSSIDTSSMHRGLYEKTQHLENKQFVE
PQYDIEEISKSKPIFVQPLSDPKPLHEGKNIHLECRLEPMGDPTMRVEWFHNGRPITVGS
RFRTYYDFGFVALDIIQATASDSGEYTCRATNHLGSAHTSACVRVIDRSDIVTETQNEMS
LEHIQQLEEASRRHYTGEEDITIMQAPQFTRPLHNIETMEGTNVHLECRLQPVGDPSMRI
EWFVNGQPLKTGHRFRPAYEFDYVALDLLGCYAADSGVYTCQARNQLGEAVTSCSVRIVA
KSDLIMETQNESGLQKIAYLEDSSRYRRSEYIDEEIVTIPPRFLTHPKSLTNTREGGRAH
FECKIEPVTDPNLKVEWFKNGRPITVGHRFRPIHDFGYVALDIVDLIAEDSGVYTCRAVN
AIGSDETQVELLCRSSEQIVTVTQNETGLQQIHHLEDRSRYSRREEIDETTKQAPVFTTS
LKNVEIKENQRAHFECRLIPVSDPSMRVEWYHNNMPLKSGSRFTETNNFGFVALDIMSCL
PEDAGTYTCRAYNAIGEAITSAVAIVHTKKAIYSESQHESALPRLQHLEESTKRQRMSAQ
EEIITQAPVFTLPVRDSRVAEGQAVHFEARLIPVGDPHLKVEWLRNGQPIEASNRITTMH
DFGYVALNMKYVNPEDSGTYTCRATNELGQAVTSASLIVQSKTSIQMETQHEAAMHKIHQ
LEDHSRYQRREEEEYVVTQAPRFVTKLIGPTNLVEGQSAHYECRIEPYPDPNLKVEWFHN
GKPLNTGHRFRTTYDFGFAALDILTVYAEDSGEYTCRVTNNLGEAINSIVLNVQSRSGIS
HETQHEEALEKIHHLEDASRYQRRVEEETYMAERPQFGRPLRNVNTNEGKPVHMEATLTP
VNDPTMKVEWYCNGVPIQTGHRFKTTYDFGFVALDILYAHAEDTGTYMCKAKNAVGEAVT
TCAVNVTANKTLDLDTLDAERLEKIRQLETHAAPKKVEVEEKGQKPIFLTPLSNLEHLKE
GEHAHLECRVEPINDPNLKIEWFCNGKQLPLGHRYRTTHDFGYVALDILYVYGEDTGTYM
CKATNFLGEAVNTCNVRVLNRRSMILDTQHPDALEKIQKLESKVPVRRTEISDQPISPPH
FSVELRGSTEIYEGETAHFEAQVQPVHDPNLRIEFYHNGKPLPSASRFHITFDFGYVALD
ITHAVAEDAGEYSVRAVNALGQCVSSTNLRVIARGTIISDTQHPEGLEKIRKLESTAPFQ
RPELETPGTKQRPVFTQPLQNIDRINEHQTAHFECRLIPVGDPNLKVEWYRNEKIIEDSS
RITKQHDFGYVSLDISHIRKEDEGVYMCRAVNPLGEAVTTASMRVVTEASIQMDTQHPDS
ISRIHQLERPPAPRPVEPERAFEKPIFTQLLTGPSEVWEGQHAHFEARVVPVGDPSLKFQ
WFINGVELQMGSRLRTTNDFGFVTLDISSIVPEDAGVYMCRAYNAAGEAVSSTAMKVKTK
ANIAGEPLIPESWEAIRLKEASMNRVPEMFVDTTPQQAPVFTTHLQSYDKLSEGQHVLLE
AQVEPRADPNLRIEWFKNGISLTTGARIRSTFDFGLVTLSINGLRADDSAIYTCKATNQI
GEAVSTCSLKIEDRHWLQAESLHPDSLPRIGELEAPKPGRPEAAEPVYETPVFITHLNNI
ECKESDSGRFECNVEPSRDPTMKIEWFYNGQPLQAAAKFKSIYDFGYCALDMSNLYAENS
GIYTCKATNSKGSATTSGTLKCTSGKIMFLDTQHPQGEAGMEAIKETEEELANRYNRDVV
KPETQYPAPVWTRPLQAEFHLSEAQPLHLEGNVEPKEDPNLFIEWYFNGKLLQHGSRFKM
TSEFGFVTLDMIEVYARDQGIYTCKAYNKAGEAFTSTTIFCDTKESIIEKTQHPKGAEGL
EQIQDLEESLRKDGSKPEKEEEGMAPRFTTEFTNIADIGEGEIAHYEANLIPTGDQSMVI
EWFFNGKVLEASHRVRTIYAFGMVALEILGTKIEDTGTYTCRATNKYGSAEISCTLECVE
KPRGQKPVFTTHIKSVEGLKDGQSAHFECTLIPVNDPDLKVEWYHNGKLMRHSNRIKTVS
DFGYVVLDISYLQDHDSGEYVCRAYNKYGEDFTRATLNCRGRGGVFYDSLQPDSLQRIRE
LECPQGHEVPSTPVVAEPPKFITQITDVTKLVEGQSAHFEARLTPITDPDLKVEWFFNGK
KLPHGHRFRTFHDFGIVILDILYCYEENSGVYECRAVNKYGEDVTRATLKCTSKANLILD
SQLPRGMEGGLEKIANLEYSMVRTRDETVEESKGKAPMFTVPLENIDNMREGENAHFEAR
VTPTDDPKLRVEWFWNGRPLKAGSRFRTFCDFGFVILEISPVYPEDSGEYSCRAINEYGE
AVTTAIMKIQGKRSIIMESQLPKGMEGTIDRIAELEGLGARSTEFVPDDDTGKPPEFITT
PFDMVINENQLAHFECRLQPINDPSMRVDWFHNGKALWSGSRIKTINDFGFVILEIAGCY
QRDSGLYTCKATNKHGEATVSCKLQVKGRQGIVMEPQLPSNFRTGTESLQKLEENMHKRE
EMVIDEEQPNPPRFTEDIKDNLDVQEGGPIHFDCRVEPVGDPTMRIDWFYNGRPLATGSR
VHQLNDFGFIALDIDYIYARDSGEYTCRATNKWGTATTTAKVTCKGKSNIVYDTQLPDGM
TAQKLKELEQGRIPDVPKEEEVDFGPPIFVTEIASTTVEEAEAVRFECQVEPKNDPNLRI
EWYRNGKLLPSGHRYRNIFDMGFVSLDILYVYAEDSGEYVCRAYNKHGEARTKATVSCKK
LPSIMLQNQVPRGMKRSETLTQMEATIKKYTSEVHLTEDDLFDPDRKQPPRFVTQIKDQT
TLTEMSKTKFECQLAPVGDPNMKVEWFFNGKPLLYKNRFQPIYDFGYVAMNFGWIYPEDS
GEYVCRATNLYGKDETRAVIKVAGKPGIVYDSQLPAHMHSIDRIREMEASWQVVPEEVDP
DAKPRSKPMFVSKLEPQTVEEGEPARFCVRVTGHPRPRVMWLINGHTVVSGSRYKLTNDG
MFHLDIPKTRQYDTGKVEVIARNSVGESIASTELNVVARSDDFRGVLKNSPRPWYDYELT
AYQKERQENELEKVFDERKQYLAEQSGTTLKGVEHLKPKQYKAEAPEWQQTVRKKKTEDY
YNKLQELDNELLLKEVNLRKDNHQYAIPGEKIVSSSQAKGMAQSYEENLQEENTTSTTKR
VVQQKPVEPSESSVHGREVHMNKQQQTQKEVVGDMEITRKITATETTEVEHKGTIQERVV
KGPVKPAKPPVFTKKIQPCRVFENEQAKFEVEFDGEPMPKIKWFRESFPIQSSPDLQIHT
FSGKSILIIRQVFVEDSAVFSCIAENHGGTAKCSANLVVEERRRAGKGGMAPPSFVNTIQ
STTVTTGQLARFDAKVTGTRPMDVYWIKNGMKLQPSIKFKMLEEDNIHTLLIIEPTAEDT
GRYECVAVNAAGEARCDADCVVQSSAKPEKPTTPGVEKAPHIVEQLKSQSVEEGSKVIFR
CRIEGKPTPTARWMRGDNYVKPSRYFQMSRQGEYYQLVISEAFPEDEGTYKCIAENKLGS
IQTSAQLKVRPIENLDAPPTITALKDVSVSEGMPAQFKTTVTGKVKPTSVQWFREGALIP
ETPDFQMIFDGNTAVLLIGTTYEEDSGVFTVRATSSTGQAESSAKLTVKSKD
NT seq 14379 nt NT seq  +upstreamnt  +downstreamnt
atgcaacggcaaaatccctcgaaccagcaacagctgcaacagcatcagcaacaacagcaa
atcatgcagcagactcagcaaacaacaatgcagagtcaccaagaaatgcatcagcaacaa
aggatcagccgcactgaacaccacgttcagaggagtcaagttaccactcaccaaagagtg
gaacaacatggcggctcctatgtaccacccggtattacacatatctactcgcaaggcgac
atctcaccaccggtattcgaagaaatcttcaagaatgctcgcttcgcccagggcggcaac
gctctgttcgaaggcaagctgcgtggcaatcccaagccattcgtaacctggactcgaaaa
ggcgcaccacttctcgagtctcaaaagttccgcatgaattacaacgaagccaccggcgag
gtatcgctgctcatcaatcagatcggacctggcgacgagggtgagtacacctgcaccgcc
cgcaaccagtatggcgaagccatttgcagcgtctacatccaaccggagggcgctccacca
atacagcccattcagaaattcgaaaagaatctgtacaccaatggctatgcctttacctcg
gttgaggaagagttccgtgtggatacctttgagtatagacttttgcgtgaggtatccttc
cgggaggccattacacgccgtgccacctatgaacaagactatcatctgagtcaggaagtg
gatcgcagcatgggcccagctcatgctccccaaattgcccagaagcctcgcaactcgaaa
cttgttgagggctcagatgctgtatttactgccaaggtgggttccaatcccaagccccgc
ctcacctggttccacaatggccaacgtttggtacaatctgccaaatacgacatctcctat
tccagcggcacagccaccatgcgcattaagaaggccactcacaaggatgctggtcattac
actttgttggctgaaaatactcagggctgtgttgtgtcttcagctgtcctggccgttgaa
ccggctgccgagtcggctcatgagcccaagcctgtggataccaccgcagaacaattggaa
gctggcaaggctttgcctcccacctttgtcaaggccttcatggatcgcgagatcaccgag
ggtcgcatgacccgtttcgattgtcgtgtcaccggcaatccctatcccgaggtctactgg
ttcatcaatggtcgccaggtcaacgatgatgccacccacaagattctggtcaatgaatcc
ggtagccattctctgatgattaccaacgtcagccgcaccgatgctggcaccgtccaatgc
ttggctcgcaacaaggctggtgaaattgccatcgaagcccagttaaatgtgctcgagatg
gagcaagttgtcgcaccacaatttgtccaacgcttcagcactatgactgtgcgcgagggc
gagcccatcaccatgagcgccaacgccattggtacaccaatgccacgcatcacctggcaa
aaggatggcgtccaaatcacctcaaccgctgatcgtttcattggcatcgatggcggtgcc
acttgtctagagataccacgtgtcaaggcatccgacgctggctggtatcagtgtactgca
caaaacgcggccggctcaacagcaaatcgtgcccgactctatgtagaagttcccagagaa
caaccaccaacagaacaaagacgtctgaatttaccaagacccacgaagatcatcgaacca
gagccccagcctggtccagaagttatttacttgcgtcatgttgaacgcgccaagccccag
aggcgtcccggtgaggaagaacgtgtctatccaccaccacaattcattgtgcccttgcaa
aatgtccagcaagttgagggttccaaagtgcatatggaagctcgcattgaaccggttgga
gatccaaccatggtagttgagtggttcctgaatggccgccccatggctgcaagctcccgt
gccacctccgtattcaagttcggtttcattgccttggacttgttgagcgtcatgtctcac
gattccggagagtatttgtgccgtgtgaccaatgcctccggcgtggccgaatctcgtgcc
attctctcagtgactcagcgtccctccattgagcaaacttcccaacacccaagcagtttg
gaatacattagcaacttggaggactactcgcgttaccagcgccaagagagcactgaggag
ttcatgaaacaggctccagtcttcattaggcccctgcatgatttgggtgacctcgaggag
ggcaagaatgctcacttcgaggcccaagtcaatccagtgaatgaccccaccatgcgtgta
gagtggtacaaggatggtcgtcccatcactgccagctcacgcatcaccgctatcttcaac
ttcggttatgtatcgctgaacattttacatttgcgcgccgaggacaccggcacctatacc
gttcgtgctgtcaacagcatgggcgaggccgtgagcaattccaatattcgcgtaaatgtt
cgatctcaagtaactgctgacctgggtataccagagcaacagcgatacatcgaaaaggta
gaggagttggaggactatagaatggcccagaagcgtcgtcatgtccatgaagttcccgag
cccattgctcctccccaattcaagactcaaattcaaaatcaagtcgatatgcgtgaaggt
ggacatgcccactttgaggcacgcctcgaaccaactggcgattccaccatgcgcattgaa
tggtacaaggatggtcagccattggaggccagctcccgcagcaccaccttcttcaacttt
ggttatgtggcactcaccatcaagcaattgaccatctatgatgccggtacctatacttgc
cgtgcctataatgccatgggcgaggacatcaccacagcccaattgagcgtcatttccaag
cacgaaatcgtctcggattcccaacatcccggtggcttggagaagatccaacatttggag
gattcttcccgctacggccgtagcgaagaggaggaggtgaccgttaagcaagctccccgc
ttcttgggtcccatgaagggcaccaacaagatcattgaaggtcaaaaggcccactttgag
gcccgagttgaacctcaaagcgatttgacaatgagcattgaatggtaccacaatggccaa
cccatatccgctgccacccgcattcaaccatactacgactttggttatgtggctttggat
attacccaagttcgggccgaggatgctggtgtctacaccgtggtggcccgcaacaagctg
ggtgaagcccaattgcagggaacaatggtcgttgaaactcgttccagcatcgacacatcc
agcatgcaccgtggcctctatgagaagacccaacacttggagaacaaacaattcgttgaa
cctcaatacgacatcgaggaaatctccaagtccaagcccattttcgtacaacctttgtcg
gatcccaagcctttgcacgagggcaaaaacattcacttggagtgccgtctcgaaccaatg
ggtgatcccaccatgcgtgttgaatggttccacaatggtcgtcccattaccgtgggatct
cgtttcagaacctattacgactttggtttcgttgccttggatattatccaagccaccgca
tcggattctggcgaatacacctgccgtgccaccaaccatttgggtagtgcccacacttcg
gcctgtgtccgtgtcattgatcgttccgacattgtgactgaaacccaaaatgaaatgtcg
ttggagcacatccaacagctggaggaagcctcccgccgccactacaccggcgaagaggac
atcaccattatgcaggctcctcaattcacccgacctctacacaacatcgaaaccatggag
ggcaccaatgtccatttggaatgccgtctgcaaccagtcggtgatcccagcatgcgcatt
gaatggtttgtcaatggccagcccctgaagaccggtcatcgcttccgtccagcctatgaa
ttcgattacgtagccctcgatttgttgggctgctatgccgccgattctggtgtgtacacc
tgccaggcaagaaatcaattgggcgaggctgttacctcctgctctgtccgcattgtggcc
aagagcgatttaattatggaaactcaaaatgagtctggtctgcagaagattgcctacctt
gaagactcgtcgcgttaccgtcgcagtgaatacatcgacgaggaaatcgttaccattcct
ccacgcttcttgacacaccccaagagccttaccaatactcgtgaaggtggtcgtgctcac
ttcgagtgcaaaatcgaaccagttaccgatcccaacttgaaagtcgaatggttcaagaac
ggccgtcccatcaccgttggtcaccgtttccgtcccatccacgactttggctatgtagcc
ttggatattgtcgaccttattgccgaggattccggtgtctacacctgccgtgctgtcaac
gccattggctcggatgaaactcaggttgagcttttgtgccgcagctccgagcaaattgtt
accgttacccaaaatgagaccggtctccaacaaatccaccatttggaagatcgttcccgt
tactcacgccgtgaagaaatcgatgagactaccaaacaggcccccgtcttcaccacttcc
ctaaagaatgtggagatcaaggaaaatcaacgtgcccacttcgagtgccgtttaatccct
gtctcggatccctccatgcgcgtcgaatggtaccacaataacatgccattgaaatcgggt
tcccgtttcaccgaaaccaacaactttggtttcgttgctttggacattatgtcctgtttg
cccgaggatgctggtacctacacctgccgtgcctacaatgccattggtgaggccatcacc
tcggctgtagctattgtccataccaagaaggccatctactccgagtctcagcatgaaagt
gccctgccacgcttgcaacatttggaggaatccacgaaacgccaacgcatgagtgcccag
gaagaaatcatcacccaggcacctgtctttacattgcccgtgcgtgattcccgtgtagcc
gaaggtcaggctgtgcatttcgaggcccgtctgattcccgttggtgacccacatttgaag
gtcgaatggttgcgcaatggtcaacccattgaggcttccaatcgcattaccaccatgcac
gactttggctatgtggctctcaacatgaaatatgtcaacccagaggattccggtacctac
acctgccgtgctaccaacgaacttggacaagccgttacttcggcttctttgattgtccaa
tcgaagacatccattcaaatggaaactcaacatgaggctgccatgcacaagatccatcaa
ctggaggatcacagccgctaccaacgccgtgaggaagaagagtacgtggtgacccaggct
cccagatttgtgaccaaactcattggtcccaccaatttggttgagggacaaagtgcccat
tacgaatgtcgcattgaaccctatcccgatccaaacctcaaggttgaatggttccacaac
ggcaagcctttgaacactggccatcgtttccgtaccacctacgattttggctttgccgct
ctcgacattttgaccgtctacgccgaggacagcggtgaatacacctgccgcgtcaccaac
aatttgggtgaagccatcaactcgattgtcctcaatgttcaatcgcgctccggcatcagc
catgaaactcaacacgaagaagccttggaaaagatccaccacttggaagatgcttcccgc
tatcaacgtcgcgttgaagaggaaacatacatggccgagagaccacaattcggccgtcca
ttgcgcaatgtcaacaccaacgaaggcaagcctgtccatatggaggccactttgacgccc
gtcaatgaccccaccatgaaagtggaatggtactgcaacggagtacccatccaaaccggt
catcgcttcaagaccacatacgatttcggtttcgtagctttggatattttgtatgcccat
gccgaagacaccggtacctacatgtgcaaggcaaagaatgctgtaggggaagctgtaacg
acttgtgctgtaaacgtaacagcaaacaagacattggacctcgacactctcgatgctgag
cgcctggaaaagattcgtcaactggagacccatgccgctcccaagaaggtggaagtcgaa
gagaagggtcaaaaacccattttcctaactcctctcagcaatttggaacatctgaaggag
ggcgaacacgctcacttggagtgccgtgtcgagccaatcaatgaccctaacttgaagatt
gaatggttctgcaatggcaagcaactgccgctaggtcatcgttatagaaccacccacgat
ttcggttatgttgccttggacatcctctatgtctatggcgaagataccggcacctacatg
tgcaaggccaccaatttcctaggcgaagctgtgaacacctgcaatgtgcgcgtattgaat
cgccgcagcatgattttggacacccaacatccggatgccttggagaagatccagaaattg
gaatccaaggttcccgtgcgccgtaccgagattagcgatcaacccatcagcccacctcac
ttcagtgttgagttgcgtggcagcaccgaaatttacgaaggtgaaactgcccactttgag
gctcaagttcagcccgtgcacgatcctaatttgcgcatcgaattctatcacaatggaaag
ccattgccctcggcctctcgtttccacatcactttcgattttggctacgtggccttggat
attacccacgctgtggccgaagatgccggcgaatattcggtacgtgctgtcaatgctctt
ggtcagtgcgtgtcctccaccaacttgcgcgtcattgcccgtggcaccatcatttccgat
actcaacatcccgaaggtttggagaagattcgtaaactggagtcgactgctcccttccaa
cgtcccgagttggagacacccggtaccaaacaacgtccagtcttcacccaacccttgcaa
aacatcgatcgcatcaatgagcaccagaccgctcacttcgaatgccgtctcattcccgtt
ggcgatcccaacctcaaggttgagtggtaccgcaatgagaagatcattgaggacagctct
cgcattaccaaacaacacgatttcggctatgtttccttggacatttctcacattcgcaaa
gaagacgaaggtgtttacatgtgccgcgccgtcaatcccctgggcgaggctgtcaccacc
gcctctatgcgtgtcgttactgaggctagtatccaaatggatactcaacatccagacagt
atcagccgcattcatcagttggagcgtccaccagcacctcgtcccgttgagcctgagcgt
gcattcgaaaagcctatcttcacccaattgcttaccggtccttcggaggtatgggaagga
caacatgcccactttgaggctcgtgtggtgccagttggtgatccatctctgaaattccaa
tggttcatcaatggcgtcgaattgcaaatgggttcgcgtttgaggaccaccaacgacttt
ggctttgtcactcttgacattagctccattgttcccgaagatgccggtgtctacatgtgc
cgtgcctacaatgctgctggtgaggctgtatcctctacggctatgaaggtcaagactaag
gccaacatcgctggcgaacccttgattcctgagtcatgggaagctattcgcttgaaggaa
gcctccatgaaccgtgttcccgaaatgttcgtggacaccacaccacaacaggctccagtc
tttaccacccatctgcaaagctacgacaaattgagcgaaggtcagcacgtccttctggaa
gctcaggtggaacctcgtgccgatcccaatttgcgcattgaatggttcaagaatggtatt
tctcttaccactggtgcgcgcatccgcagcactttcgatttcggtttggtcactttgtcc
atcaatggcttgcgtgccgacgattcggccatctacacttgcaaagccaccaaccaaatt
ggcgaagccgtatccacttgctccctcaagattgaagatcgtcattggttgcaagccgaa
tctctgcatcctgattctttgcctcgcattggtgaattggaggcccccaaacctggtcgt
cctgaggccgctgaacctgtctacgagactcccgtcttcattactcatttgaacaacatt
gagtgcaaggagagcgatagcggtcgcttcgaatgcaatgttgaaccatcacgtgatcct
accatgaagattgaatggttctacaatggccaacctttgcaagccgctgccaaattcaag
tccatctacgactttggctactgtgccttggacatgtccaatttgtatgctgagaacagc
ggtatctatacttgcaaggccaccaacagcaagggctcagccaccacatcgggtaccttg
aagtgtaccagtggcaagattatgttcctcgatacccaacatcctcaaggcgaggctggt
atggaggccatcaaggaaactgaggaggaattggcgaatcgttataaccgcgatgttgtc
aagccagaaacccaatatcctgcccctgtctggaccagaccattgcaggctgagttccat
ttgtccgaagctcaacccttgcacttggagggtaatgtggaacccaaggaggatcctaac
ctcttcattgaatggtacttcaatggcaagttgttgcaacacggttctcgtttcaagatg
accagcgaattcggtttcgtcaccttggacatgattgaagtgtatgcccgtgatcagggt
atttacacctgcaaggcctacaacaaggccggtgaagccttcacctcaaccacaatcttc
tgcgacaccaaggaaagcattatcgaaaagacccaacatccaaagggtgccgaaggcttg
gaacaaattcaagacttggaagaatctctgcgcaaggatggcagcaaacccgagaaggaa
gaagaaggtatggctccacgcttcaccactgaattcaccaacattgccgacattggtgag
ggtgaaattgctcactacgaggccaatcttatcccaaccggagaccaaagcatggtcatt
gaatggttcttcaatggcaaggttttggaggcaagtcaccgtgtccgcaccatttacgcc
tttggcatggttgctttggagattttgggtaccaagattgaagacaccggtacctacact
tgccgcgccaccaacaaatatggctctgccgaaattagctgcactttggagtgcgttgag
aaaccacgtggccagaaaccagtcttcaccacccacatcaaatccgtggagggtcttaag
gatggccaatcggctcacttcgaatgcactctcatcccagtcaacgatcccgaccttaag
gtggaatggtaccacaacggcaagctcatgcgtcactcgaatcgcatcaagaccgtatcc
gatttcggctatgtcgtcttggatatttcctacttgcaagatcatgacagtggtgaatat
gtgtgccgtgcctacaacaaatacggcgaggactttactcgtgccaccctcaactgccgt
ggtcgcggcggtgtcttctacgacagcttgcaacctgattctctgcaaagaatcagagaa
ttggaatgccctcaaggccatgaggtgccttcgacacctgttgtcgccgaaccacccaag
ttcattacccaaatcaccgatgtcaccaaattggttgaaggtcaaagtgctcactttgag
gctcgccttacacccatcaccgatcctgatcttaaggtggaatggttcttcaatggcaag
aaattgccacatggtcatcgtttccgtactttccacgatttcggcattgttatcttggac
attctgtactgctatgaggagaactctggtgtttatgaatgccgcgccgtcaacaaatat
ggcgaagatgtgaccagagccacactcaagtgcacatccaaggccaacttgattttggac
tctcaattgccacgtggcatggaaggtggtttggagaagattgccaatctggagtacagc
atggtacgcactcgcgacgaaactgttgaggaaagcaagggcaaggcccccatgtttact
gtgcccctggagaacatcgacaacatgcgtgagggtgaaaatgctcacttcgaggctcgt
gttacacccacagatgatcctaaacttcgcgtcgaatggttctggaatggccgtcctctt
aaggccggttctcgcttccgcacattctgtgactttggctttgttatcttggaaatatcg
cccgtctacccagaagattcgggtgaatactcctgccgtgccatcaatgagtatggtgaa
gctgtgaccacagccattatgaagattcaaggcaagcgcagcatcattatggaatcgcaa
ttgcccaagggcatggaaggcaccattgatcgcattgctgagttggaaggtttgggtgct
cgcagcacggagttcgtgcccgacgatgatactggcaagccaccagaattcattaccaca
cccttcgacatggtgatcaatgagaatcaattggcccactttgagtgccgcctgcaaccc
atcaacgatcccagcatgcgtgttgactggttccacaatggcaaggccttgtggtctgga
tcacgcatcaagaccatcaatgactttggttttgttattttggaaattgccggatgctac
caacgcgacagtggtctttacacctgcaaggccaccaacaagcacggcgaagccacagtg
tcgtgcaaattgcaagtcaagggacgccaaggcatcgtcatggaaccccaattgccatct
aacttccgtaccggcaccgagagccttcagaagctcgaagagaacatgcacaaacgcgag
gagatggtcatcgatgaggaacaacccaatccacctagattcactgaggacatcaaggac
aatttggatgtccaagaaggtggtcccattcactttgattgccgtgtcgaacctgtcggc
gatcccacaatgcgtatcgattggttctataatggacgtcctttggccaccggttcccga
gtgcatcaactcaacgactttggcttcattgccttggacattgactacatttatgctcgt
gattctggtgaatatacctgtcgtgccaccaacaaatggggcactgctaccaccactgcc
aaggttacctgcaagggcaagagcaacattgtctacgacactcaattgcctgatggtatg
actgctcaaaaacttaaggaattggaacagggccgtattcccgatgtgcccaaggaggaa
gaggtcgatttcggaccaccaatctttgtcacagaaattgcctcgaccaccgtcgaagaa
gctgaagccgtacgcttcgaatgtcaagtggagcctaagaatgatcccaacttgcgcatt
gaatggtatcgcaacggcaagctgttgccttcgggtcaccgctacagaaatattttcgac
atgggctttgtatcgctggacattttgtatgtctatgctgaggattcgggtgaatatgta
tgtcgtgcctacaacaagcacggcgaagcacgcaccaaggccaccgtgtcatgcaagaaa
ctgccatcaattatgttgcaaaatcaagtgccacgtggcatgaaacgctctgagacctta
acccagatggaggctacaatcaagaaatatacctccgaggtacatttgaccgaagatgat
cttttcgatccggatcgcaagcaaccacctcgttttgtgacccaaatcaaggatcaaacc
actttgaccgaaatgagcaagaccaagtttgaatgtcagttggcaccggtcggtgatccc
aacatgaaggtggaatggttcttcaatggcaaaccattgttgtacaagaatcgtttccaa
cctatctacgatttcggttatgtagccatgaactttggctggatctatcccgaagatagc
ggtgaatatgtttgcagggccaccaatttgtatggcaaagatgagaccagagctgtcatt
aaggtagctggtaaaccaggcattgtctatgactcccaattgccagctcatatgcacagc
attgatcgcattcgcgaaatggaagcctcttggcaagttgttcccgaagaagttgatcct
gatgccaagcctagatcgaaacccatgtttgttagcaaactggaaccacaaaccgtggaa
gagggcgaacctgctagattctgtgtgcgtgtaactggccatcccagaccccgagtcatg
tggttgatcaatggccatacagttgtatctggttcacgttacaagctcacaaacgatgga
atgttccatttggatattccaaaaacacgtcaatacgataccggtaaagtcgaagtcatt
gctcgcaattctgttggcgaatcaattgcctcaaccgaattgaatgttgtggcccgttcc
gatgatttccgtggcgtccttaagaattcaccacgtccttggtacgactatgaactgact
gcctatcaaaaggaacgtcaagaaaacgaacttgaaaaggtattcgatgaacgcaagcaa
tatttggccgaacaaagtggtaccactttgaagggcgttgaacatctcaagcccaagcaa
tacaaggctgaagctccggaatggcaacagactgtgcgcaagaagaagaccgaagattat
tacaacaaattgcaggaattggacaatgaactgctattgaaggaagtcaatttgcgcaag
gataatcatcagtatgccattcctggcgaaaagattgtcagcagttcacaagccaagggt
atggcccagtcctatgaggagaacttacaagaagaaaacaccacaagcactaccaaacgt
gtcgtccagcaaaagcccgtggaaccgtctgaatcatcggtccatggccgtgaagttcac
atgaacaaacaacaacaaacccaaaaggaagttgtcggcgacatggagattacccgcaaa
ataaccgccactgaaacaactgaggtagaacacaagggcaccatccaagaacgtgtggtc
aagggccccgttaagccagccaagccaccagtattcaccaagaagatccagccctgccgt
gtcttcgagaatgaacaggccaaattcgaagttgaattcgatggtgaacccatgcccaag
atcaaatggttccgcgaaagcttccccattcaaagctcacccgacttgcaaatccacaca
ttcagtggcaagtcgattttgattattcgccaagtgttcgttgaagactcggccgtattc
tcttgcattgccgagaaccatggaggcaccgccaagtgcagtgccaatttggtcgttgaa
gaacgccgtcgtgctggcaagggtggcatggctccccccagctttgtaaataccattcaa
agcactactgtgaccaccggtcagttggctcgtttcgatgccaaggtcaccggtacccgt
cccatggatgtctactggatcaagaatggcatgaagctacagcccagcattaagttcaag
atgctggaggaggacaatattcacacattgttgatcattgaaccaactgccgaagatacc
ggccgctacgaatgtgttgccgtgaatgctgctggcgaggctcgctgtgatgccgattgt
gttgttcaatcctcagccaaacccgaaaaacccactaccccgggtgtagagaaggctcct
cacattgtcgaacaattgaagagtcagtctgtggaagagggtagcaaggtaatcttccgt
tgccgcatcgagggtaaacccactcctacggctcgctggatgcgtggtgataactatgtg
aagccttcacgttacttccaaatgtcccgtcaaggtgaatactatcagcttgtcatctcc
gaggccttccccgaagatgagggcacctacaagtgcattgccgagaacaaattgggtagc
attcagaccagtgctcaattgaaggtgcgaccaattgagaatttggatgctccacccacc
attaccgctctgaaggatgtcagcgtgtcggagggtatgccagcccaatttaagacaaca
gtgacgggcaaagtgaaaccaaccagtgttcagtggttccgtgaaggtgctttaattccg
gaaacaccagattttcaaatgattttcgatggcaatacagccgtactattgatcggaaca
acctatgaggaagattccggtgtatttaccgtacgtgcaacctcatccacaggacaagct
gaatcatcggccaaattaactgtaaaaagtaaggattaa

DBGET integrated database retrieval system