KEGG   Musca domestica (house fly): 101895854Help
Entry
101895854         CDS       T03448                                 

Definition
(RefSeq) probable low-specificity L-threonine aldolase 2
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
mde  Musca domestica (house fly)
Pathway
mde00260  Glycine, serine and threonine metabolism
mde01100  Metabolic pathways
mde01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mde00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    101895854
Enzymes [BR:mde01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     101895854
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_1_2 DegT_DnrJ_EryC1 Cys_Met_Meta_PP
Motif
Other DBs
NCBI-GeneID: 101895854
NCBI-ProteinID: XP_005188537
UniProt: A0A1I8NCK1
Position
Unknown
AA seq 391 aa AA seqDB search
MPPANSTTSANYVVDIRSDTVSLPTKEMRQAMLEAVVGDDVYGEDPTVLQLEQTSAKLFE
KEAALFVPSGTMANLLAIMVHCHRRGTEAIVGDISHTFLYEQAGAAQIAGVQLATIKNKP
DGTFCLREMQHKLRLYDDCHEPVTALVVVENTHNMCGGKALPLEWLDELAAICKDPVKTN
GKRIALHMDGARIFNAATYLKVPVSRITKDFDSVCFCLSKGLSAPVGSVLVGNKTFINEA
RRLRKVLGGGMRQCGVLAAAGLVALETIVPRLNEDHQRTKRIAEALFNIHSPNISVDLAN
VHSNILLIHMVNPKVTADEFAKRLGTVTAQELADGVITSAEDGASGIVLKVSARDWAYAR
IVLYHQITDKDVEYTIKKFEYVVKEFDRQLA
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgccaccagccaattcaacgacgtctgccaactatgttgtcgatattcgttcggacaca
gtgagtctaccgaccaaagaaatgcgccaggccatgttagaagctgtggtgggtgatgat
gtttatggtgaagatccaaccgttttgcaattggaacaaacatccgcgaagctatttgaa
aaagaagccgccttgtttgtacccagtggtactatggcgaatttattggcaattatggtt
cattgccatcgtcgcggcaccgaagccatcgttggtgacatttctcacacattcctttac
gagcaagcgggagctgcacaaattgccggtgtacaattagccacgataaaaaacaaaccc
gatggcaccttttgtctcagagaaatgcaacataagttacgactctacgatgattgtcac
gaacctgttacggcactggtagttgtggagaatacccacaacatgtgcggtggaaaggca
ctgcctttggagtggttagatgaactcgcggcaatatgtaaggatcccgtcaagacaaat
ggcaaacgcattgccctccacatggatggtgctcgcatttttaatgcagccacatatttg
aaggtgcccgtgtcgcgcataaccaaagatttcgattcggtgtgcttttgtctgagcaag
ggactgtcggcaccggtgggttctgtattggtcggcaataaaacattcattaatgaagct
cgtcgtctgcgtaaggtcttgggtggtggcatgcgacaatgcggtgtactagctgctgct
ggcttagtggctcttgagacaattgtaccacgcttgaatgaggatcatcaaagaacaaaa
cgaatcgcagaagctctgtttaatatacacagccccaacatttccgttgacctagccaat
gtgcactcaaatattctgttgattcatatggttaatcccaaagtaactgccgatgagttt
gccaaacgtctgggtacagtaacagctcaagaactggcggatggcgtaatcaccagcgca
gaggatggagccagcggtattgtattgaaggtcagtgcccgtgactgggcatatgcacgc
attgtgctgtatcatcagattaccgataaggatgtggaatatacaattaaaaagtttgaa
tatgtcgtcaaggaatttgatcgtcagttggcatga

DBGET integrated database retrieval system