KEGG   Musca domestica (house fly): 101896621Help
Entry
101896621         CDS       T03448                                 

Definition
(RefSeq) receptor-type guanylate cyclase Gyc76C isoform X1
  KO
K01769  guanylate cyclase, other [EC:4.6.1.2]
Organism
mde  Musca domestica (house fly)
Pathway
mde00230  Purine metabolism
mde01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mde00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    101896621
Enzymes [BR:mde01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.2  guanylate cyclase
     101896621
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Guanylate_cyc ANF_receptor Pkinase_Tyr Pkinase HNOBA
Motif
Other DBs
NCBI-GeneID: 101896621
NCBI-ProteinID: XP_005177218
UniProt: T1PCH4
Position
Unknown
AA seq 1576 aa AA seqDB search
MKRWPFIILHLLSVAVVLIPSVRCVRSTGERTVINVGYLTALTGELKDKQGLAISGALTM
ALEEINNDTSLLPNVQLTLRWNDTKGDTVLATKAITEMICDGIAMIFGPEGHCYVEAIVT
QSRNIPMISYKCPENKASSIPTFARTEPPDTQVIKSVISLLRYYGWKKFSILHDESWTMV
AELLKVEAIKKNMTINHKESFIDNMAKCCEEMLACCRTGFWYQIVQNTMNRTRIYVFLGT
ANALVEFMASMDTANLFSKGEYMVIFVDMMTYTPKEAEKYLRKPEQVEHMTSCGETDAFI
QRARSLLVVASTPPTDSYENFTAKVREYNLKQPFNFTLPQLFHSNNFIKFVSIYAAYLYD
SAKLYAWALDELLRNSTGDRPLTSEEIYNIASDGTKIIETIIKNGTYKSVTGATIKIDNN
GDSEGNFSVLAYKPFKYSYRENLQCNFHMVPVAHFQQGTDIPEYKLINGSMRVDWPSGGD
RPFDEPMCGFANELCKKDDRHITSLVAAGILGLLLFCAGVVTMSIYRKWKIELEIEGLLW
KIDISEIKGYAVNDMVSSPSKLSLVSAQSFGSRCSNQVFTSTARLRGAVVRIKELKFLRK
KDMSREIMKEMRLLRELRHDNVNSFIGACVEPMRILLVTDYCAKGSLYDIIENEDIKLDD
LFIASLIHDLIKGMIYIHNSSLVFHGNLKSSNCVVTSRWMLQVTDFGLHDLRHCAESESI
GEHQHYRNQFWKAPELLRNPHVYGSQKGDVYAFAIIMYEIFSRKGPFGQTLYEPKEIVDL
VKKEPTTGHLPFRPELECIIEGELCPDYVLSCITDCWHEDPEVRPDFPTIRTRLKKMRGG
KTKNIMDQMMEMMEKYANNLEDIVTERTRLLCEEKRKTEDLLHRMLPQSVAEKLTMGLGV
EPVSYDLVTIYFSDIVGFTAMSAESTPLQVVNFLNDLYTVFDRIIRGYDVYKVETIGDAY
MVVSGLPIKNGDRHAGEIASMSLELLQAVKQHRIAHRPNETLKLRIGMHTGPVVAGVVGL
TMPRYCLFGDTVNTASRMESNGEALRIHISSKCKEALDKLDGYITEKRGLVNMKGKGEVV
TYWLVGATEKAIQKKPVDMTDLPPPLFCRPRKSPKLNSDSRQPSIVGMHFAGGGSRRQSN
SVPRADMESNYSLQGSTHQVLRDSPRLPSKRNDRPSANGVGSFQDNSIPEHMGFCGSGAS
YGVGFSDILPESPRISHSTLEHSETNCDNSGVGVNGDISSSFCTSRLIASLSQKPLAMVR
PHRIVNYPNSSQDYYGSGYISGTSVVAHHNLREARSLDPIPFQLRKRHEPKILPPSKLSK
NNSRSLDAGVSLISDNPNGTTGTASSQAQDSNSDGERRCKAPLTEPNSTQMSEEFEDDIG
LLLSRDNGDLNKRNSVSIVPAGSSVLNRRRSGGGFSIAGLSSGNTGVSMLPYKHLNNNCN
GGMTIEEDVQAPLLQRQASLTTTPTLEKAKRWHSLEGIQHHTVNSVSYAADIDGRQAEAS
SSSSKAASNKKSSHRNAPGNGNSSSFLDRLVSIFHGNGKKGTNSSMRRVGILPSSVRGVP
GFNDLSSSSRDRESIV
NT seq 4731 nt NT seq  +upstreamnt  +downstreamnt
atgaagcggtggccctttatcatcttgcatttgctctcggtggcagtagttctgattccg
agtgtgagatgtgtgcgcagtactggggagcggactgttatcaatgtcggttacctgacg
gcattgacaggtgagctgaaggataagcagggcttggctatatccggggccttgacaatg
gccttggaagagatcaataatgacactagtctattgcccaatgttcagctgacactacgc
tggaatgacaccaaaggtgatacagtcctagccaccaaagcgataacagaaatgatctgt
gatggcattgcaatgatattcggacccgaaggtcattgttatgtcgaggcgatagtcact
caaagtcgtaacattccaatgatatcatataaatgtccagaaaacaaagcatcatcaata
ccaacttttgcccgaaccgaacctcctgatacacaggtaatcaaatctgtcatttctctg
ttgcgttactacggctggaaaaagttctccattctgcatgacgaaagttggactatggtc
gcggaactgcttaaagtggaggccattaaaaagaacatgaccatcaatcacaaggaatca
ttcatagacaacatggccaaatgctgtgaagagatgctggcatgttgtcgtacgggcttt
tggtatcagattgttcaaaacactatgaatcggacgcgcatctacgtctttcttgggacg
gccaatgctctggtggagttcatggcttctatggacacggcgaatcttttctccaaaggc
gagtatatggtcatatttgtggacatgatgacttacacaccgaaagaagccgaaaagtat
ttgcgaaagccagagcaagtagagcacatgacgagttgtggtgaaacggatgctttcatt
cagcgcgccagaagtttgctggtggttgcttccaccccacccacggacagctacgagaac
tttactgccaaagttagggagtacaatctgaagcagccgttcaacttcaccttgccacaa
ttatttcacagcaataatttcatcaagtttgtttctatatatgccgcttacctttatgac
tctgccaagttgtatgcctgggctttggatgaattactgcgtaattcaactggagaccgc
cccttgacctctgaggagatatacaatatagccagcgatggaacgaaaatcattgagacc
ataattaaaaatggcacctacaaaagtgttacgggagccaccatcaaaatcgacaacaat
ggggattccgaaggtaacttctcggtgttggcttacaaaccgtttaagtattcataccgg
gaaaacttacaatgtaatttccacatggtaccagttgcacatttccaacaaggaactgat
attccagaatacaaacttatcaatgggtctatgcgtgtggactggccttcaggcggagac
cggccgtttgacgagcccatgtgtggatttgccaatgagctgtgtaaaaaggatgatcgg
catataacttccttagtggcagccggtattctgggcctgctacttttctgtgccggcgta
gtaaccatgagtatataccggaaatggaagattgaattggaaatcgaaggtttactgtgg
aaaattgatatatcggaaataaaaggttatgccgtaaatgacatggtctcgtctccaagt
aagttaagcctggtgagtgcacagtcatttgggtcgcggtgctcgaaccaagtatttaca
tcgacagcccgactacgtggagctgtggtccgcataaaggaattgaaattcttgagaaaa
aaggacatgtcacgggaaatcatgaaggaaatgcgtctgttgcgcgaactccgtcatgac
aatgtgaatagttttattggcgcctgtgtggagccaatgagaatccttctagtcacggac
tactgtgcaaagggaagcttatacgatatcattgaaaatgaggacattaaactggacgat
ttgttcatagcgtccttgattcacgatctcataaagggaatgatttatatacacaactca
tcattagttttccatggaaaccttaaatcatctaattgcgtggttacatcgaggtggatg
ttgcaggtcacagattttggattgcacgatctgaggcattgcgccgaaagcgaatcaata
ggagagcatcaacactacagaaatcagttctggaaggcaccagagcttttgagaaacccg
catgtttatggctcccagaagggagatgtttatgcctttgccattattatgtatgaaata
ttcagtaggaagggaccatttggacaaactctgtacgagcctaaggaaattgtagatttg
gtaaagaaggagcccacgacggggcacttgccatttcggccggagcttgagtgcattatt
gagggagagttatgtcccgactacgtcctaagctgtataacagactgttggcatgaagat
ccagaggttaggcccgactttcccaccataagaacacgtcttaagaaaatgaggggtggc
aaaacgaaaaacattatggatcaaatgatggagatgatggagaagtacgccaacaatttg
gaagacattgtcacggaacgcactcgtctgttgtgtgaagagaagaggaagacagaagat
ctactgcatcgtatgttgccgcagtctgtggctgaaaaactcacaatgggattgggtgtg
gaaccagtttcctatgatttggtcaccatatacttcagcgacattgtcggttttactgcc
atgtcagcagagagtacaccgctacaagttgtgaatttccttaacgatttatacaccgtg
ttcgaccgcatcatcaggggttacgatgtctacaaggttgagacaattggggatgcatat
atggtagtgtccggcttgccgataaagaatggcgatagacatgcaggcgaaatagcttca
atgtccttggagctacttcaagcggtaaaacagcacagaattgcccaccgacccaacgaa
acgctcaagttgcgcattggaatgcatactgggcctgtggttgcgggcgttgtgggtctc
acaatgccacgctattgtctctttggtgacactgtgaacaccgcgtcccggatggagtca
aatggcgaggcattaagaatacacatctcaagcaaatgtaaggaagccttagataaactg
gacggttatataaccgagaaacggggtctagtcaatatgaagggcaagggtgaggtcgtc
acttactggctcgtgggcgccacagagaaggccatacaaaagaaaccagtggacatgacc
gatttaccgccgccgttgttttgccgtccgcgaaaaagtcccaaactaaattctgattcc
agacagcctagtattgtcggcatgcatttcgccgggggcggttcgaggcgacaatccaac
agtgttccacgagctgatatggaatctaattatagcctacagggttccacgcatcaagtg
ctacgtgattcgccccgtttgccttcaaagcgcaacgatcgtccatcggcaaacggggtg
ggtagttttcaagacaatagcatacctgagcacatgggcttctgcgggagcggcgctagc
tatggcgtcggtttctcagatatcttgccggagtctccgcgaatatcgcacagcactctg
gagcattccgaaacaaactgtgataatagtggcgtgggcgtcaatggcgacatcagttct
tcattttgcacttcacgccttattgctagtctttcacaaaaacctctggcgatggtgcgc
ccacatagaattgtcaactatccaaactcgtctcaggattactatggtagtggatatata
agcggcacttctgtggttgctcatcataatctgcgagaagcccgatctcttgatcccatc
cccttccagctgcgaaaacggcatgaaccaaagatactgccaccatccaagcttagcaaa
aataattccaggtctttggatgcaggtgtatcacttataagcgataatccaaatgggact
acaggcacggcgtcgtcccaagcgcaagattcgaactcagatggggagcgaagatgtaaa
gcaccactcactgaaccaaactctacgcaaatgtcagaggaattcgaagacgatattggg
ctattgctgtcacgtgataatggtgacctgaacaaaagaaattcagtctcaatcgttccc
gctggatcatctgtgcttaatagacgacggagcggcggtggcttctccattgctggcctc
agttcggggaatacgggtgtttcaatgttaccctataaacatcttaacaacaattgtaat
ggtggcatgactatcgaagaagacgtccaggccccactgttgcaacgtcaggcttctcta
actacaacacctaccctagaaaaggccaagcgatggcattcacttgaagggattcaacac
cataccgtcaatagtgtcagctatgcagccgacattgacggtcggcaagccgaggcaagt
agctcatcgtctaaggcagcaagcaacaaaaaatcatcccaccgcaatgcacccggcaat
ggaaattcgtcctctttcctggaccgcctggtgagtatattccacggcaacgggaaaaaa
ggcaccaactcctcaatgcgccgtgtaggcattctgcccagctctgtaaggggagttcct
ggattcaacgacctaagcagctcatcacgagaccgcgaaagtatagtgtaa

DBGET integrated database retrieval system