KEGG   Musca domestica (house fly): 101897628Help
Entry
101897628         CDS       T03448                                 

Definition
(RefSeq) calcium/calmodulin-dependent protein kinase type 1
  KO
K08794  calcium/calmodulin-dependent protein kinase I [EC:2.7.11.17]
Organism
mde  Musca domestica (house fly)
Brite
KEGG Orthology (KO) [BR:mde00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mde01001]
    101897628
Enzymes [BR:mde01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     101897628
Protein kinases [BR:mde01001]
 Serine/threonine kinases: CAMK group
  CAMK1 family [OT]
   101897628
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Kdo RIO1 APH Pkinase_fungal
Motif
Other DBs
NCBI-GeneID: 101897628
NCBI-ProteinID: XP_005181847
UniProt: A0A1I8MRJ3
Position
Unknown
AA seq 456 aa AA seqDB search
MPLFGKKDSAKKTKSKEFIKELNKTIPIEDKYNLHGLLGTGAFSEVRLAESKENPGQHFA
VKIIDKKALKGKEESLENEIRVLRRFSANHHNNDTAADSRSGERLTHPNIVQLYETYEDK
SKIYLVMELVTGGELFDRIVEKGSYTEKDASDLIRQILEAVDYMHEQGVVHRDLKPENLL
FYSPDDDSKIMISDFGLSKMEDSGIMATACGTPGYVAPEVLAQRPYGKAVDIWSIGVISY
ILLCGYPPFYDENDANLFAQILKGEFEFDSPYWDDISDSAKDFIRHLMCVSVEKRYTCKQ
ALAHPWISGNAAGNKNIHATVSEQLKKNFAKSRWKQAYLAATVIRQMQRMALSSNESKSN
LLKESKMSQDNLGASSGSDVEMTTCHNASGSSSGNLLNKPNSCTNKTSSTPSPSSSSAQM
DFQSQRISSTSAAAATTTTLSSAAASCHNGSKQSNK
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
atgccgctgtttggcaaaaaggattcggctaaaaaaaccaagtcgaaggaattcattaag
gaactcaacaaaaccatacccattgaggataaatacaatctgcatggcctattgggtacg
ggcgccttctctgaggtacgcctggccgagagcaaggaaaacccaggtcaacattttgcg
gtaaaaatcattgacaaaaaggcactcaaaggcaaagaggaatcgctggagaacgagata
cgcgtcttgcgtcgtttcagtgccaatcatcacaacaatgatacggcagccgatagccgc
agtggggagcgtttgacccatcccaacatagtccagttgtacgaaacctatgaggacaaa
tcaaaaatctatttggtcatggaattggtaacaggtggtgagctattcgatcgcattgtg
gagaagggttcctacaccgaaaaggatgcctccgatttgattaggcaaattttggaggcc
gtcgactatatgcacgaacagggtgtggtacacagggacttgaagccagagaatctgctc
ttctacagccccgatgatgacagtaaaattatgatcagcgactttggtctgtctaaaatg
gaagattccggcatcatggccacggcctgtggcacaccaggctatgtggcgcccgaggtc
ttggcccagagaccatacggcaaggctgtggatatttggagtataggtgtcatttcctat
atccttttgtgtggctatccgccgttctacgatgaaaacgatgccaatctctttgcccaa
atactcaagggagaattcgaatttgactcaccatattgggatgacatcagtgattcggcc
aaggatttcatacgccacttgatgtgtgtctcggtggagaaacgttacacctgcaaacag
gccctggcccatccctggatttcgggtaatgctgcaggcaacaagaatatccatgccacg
gtttcagagcaacttaaaaagaatttcgccaaatcgcgttggaagcaggcctatttggcc
gccaccgtcatacggcaaatgcaacgtatggccctcagttcgaatgagagcaagtcgaat
ctattgaaggagagtaaaatgtcacaggataatttgggcgccagcagtggcagtgatgtg
gaaatgaccacctgtcacaatgccagtggcagtagttcgggcaatctcctcaacaaaccg
aattcgtgtacgaacaaaacatcgtccacaccatcgccgtcatcatcatcagcgcaaatg
gattttcaaagccaaagaatctcatcgacatcagcagcagcagcaacaacaacaacattg
tcctcagcagcagcgtcctgtcataatggcagtaaacaatcaaacaagtaa

DBGET integrated database retrieval system