KEGG   Musca domestica (house fly): 101898124Help
Entry
101898124         CDS       T03448                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: multiple inositol polyphosphate phosphatase 1
  KO
K03103  multiple inositol-polyphosphate phosphatase / 2,3-bisphosphoglycerate 3-phosphatase [EC:3.1.3.62 3.1.3.80]
Organism
mde  Musca domestica (house fly)
Pathway
mde00010  Glycolysis / Gluconeogenesis
mde00562  Inositol phosphate metabolism
mde01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mde00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    101898124
   00562 Inositol phosphate metabolism
    101898124
Enzymes [BR:mde01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.62  multiple inositol-polyphosphate phosphatase
     101898124
    3.1.3.80  2,3-bisphosphoglycerate 3-phosphatase
     101898124
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_2
Motif
Other DBs
NCBI-GeneID: 101898124
NCBI-ProteinID: XP_019890837
Position
Unknown
AA seq 455 aa AA seqDB search
MYITQLIFIVLLSPVLAEVCNDEISRRDIESRLSTKTPYRAIANLNDKPPVVVEGCRPSR
LWSTIRHGTRNPSKKVIKQAKSKLTALKEELLTKEDTELCPKFFENLRTWSFNISADEEK
YLVAEGEDELIELAERMQNRFPTLLAEEYDPQMFYFKYTATQRTLKSAQSFATGLFGRHR
IREIIYPEPLSKDPVLRFYKLCSRWQSDVDKNPQTFDNVRKFLQGEHMLDAILYVQKKTK
LTQLDASLLRLIYTICGFETAWQRHKPPSVWCQLLDRKTMDVLEFAEDLEYYWNDGYGFD
LTHRIACPAIQNMFKHIEXVLEINARLQLVTNSNXVSSPQSPLPNSTFYFTHSGTLLKLL
AHLGLYKDPTALTYQDFGKPRKWRTSEIDAFATNVAFVLYECDNDEPQVLTMHQERIVHL
PGCPQDSDLCSLNTLRQLYAAASLDNCNFDEMCFK
NT seq 1368 nt NT seq  +upstreamnt  +downstreamnt
atgtatataactcagttgatttttattgttttactatcccctgtccttgctgaagtctgt
aatgatgaaatctcaagaagggatattgaaagtcgtttatcaacaaaaacaccatatcgg
gccattgcaaacctcaacgataaaccaccagttgttgtggaaggatgccgcccatcacgt
ttatggtctaccatacgacatggtaccagaaatcccagcaaaaaagtcattaaacaggcc
aaatccaaattgacagcccttaaagaggaactcttgacaaaagaagacactgaactgtgc
cccaaatttttcgaaaatttaagaacttggtcatttaatatttcggcagatgaagagaag
tatttagtagctgagggtgaggatgaattaattgagttggcagaacgcatgcaaaaccgt
ttccccaccttgttggccgaagaatatgatccgcaaatgttctatttcaaatatactgcg
acccagaggacattgaaaagtgctcaaagctttgccactggattgtttggcagacatcga
atacgggaaattatttatccggaaccgttgtcaaaggatccggtactaaggttttataaa
ttgtgtagtcgctggcaaagtgatgtcgataaaaatcctcaaacatttgataatgtgcgt
aaatttctccaaggcgaacatatgctggatgccatcctctatgtccaaaagaaaaccaag
ttaacacaactcgatgctagccttctacgtcttatttataccatttgcggtttcgaaacg
gcctggcaaagacacaagccaccctcagtttggtgtcaattgttggatcgaaaaacaatg
gatgttttagagtttgccgaagatttggagtactattggaatgatggctatggctttgat
ctaacacatcgaattgcttgtccagccatacagaatatgtttaagcacattgagtgagta
cttgagattaatgcacgccttcagttggttactaatagcaattgagtttctagcccccaa
tcaccattgccgaattcaacgttttattttacgcattccggaacattgcttaagcttttg
gcgcatttgggtctatacaaagatccaacagcattgacataccaggactttggcaagcca
cgtaaatggcgtacaagtgaaattgatgcgtttgccacaaatgtggcatttgtcttgtat
gaatgtgataatgacgagccgcaggttctgacaatgcaccaagagcgtatagtccacctt
ccgggatgtccgcaagacagtgatttgtgtagtttaaataccttgcgccagttatatgcc
gccgccagtttggataattgcaattttgatgagatgtgttttaagtag

DBGET integrated database retrieval system