KEGG   Musca domestica (house fly): 101898898Help
Entry
101898898         CDS       T03448                                 

Definition
(RefSeq) ATP-dependent RNA helicase DHX8 isoform X1
  KO
K12818  ATP-dependent RNA helicase DHX8/PRP22 [EC:3.6.4.13]
Organism
mde  Musca domestica (house fly)
Pathway
mde03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:mde00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    101898898
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:mde03041]
    101898898
Enzymes [BR:mde01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     101898898
Spliceosome [BR:mde03041]
 Complex C
  Other components
   Step II factors
    101898898
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: OB_NTP_bind HA2 Helicase_C S1 DEAD AAA_22 AAA_19 T2SSE AAA_30 Flavi_DEAD
Motif
Other DBs
NCBI-GeneID: 101898898
NCBI-ProteinID: XP_005188641
UniProt: A0A1I8MJW9
Position
Unknown
AA seq 1267 aa AA seqDB search
MDELQKLEHLSLVSKLCTELDNHLGINDKDLAEFIIELESKNPTFEGFRKALVENGAEFP
DSLISNLQRIIKLMKPSGGGANGDKSAAAGGADSSGNKSSKTEQLAVMFPGLAMPNDKFS
KVDEPESHSENDSDADEKKTKKKKDIIKKVEEEDMKAVDDAMLELEALAPGFASKVETKD
IKKKVEKRSRSRSRSRERHRDRDRKRDRSRERTKDLDSSRSQDKDRRHRERERRSRSRSR
HRGERKRSRSRSRENSRRHRRSRSRSRDRRRRSRSRSKERSRHHRRSRSRENKREKMPPP
APMPDDPEPGKIYTGKVANIVPFGCFVQLFGLKKRWEGLVHISQLRSEGRVTDVTEVVNR
NSTVKVKVMSITGQKVSLSMKEVDQETGQDLNPLSHAPPPENELKDRNPDRPFGGGTSLL
NLQGGADNDESDSRKRVTRISSPERWEIKQMISSGVLDRSELPDFDEETGLVHKDEDDEE
DIEIEIVEEEPPFLAGHGRALHDLSPVRIVKNPDGSLAQAAMMQSALSKERREQKMLQRE
QDMDAVPTGLSKNWIDPLPDEDSSRTLAANVRGMGAAPMEVPEWKKHVIGGKKSSFGKKT
DMSLVEQRKSLPIYKLRDDLIKAVTDNQILIVIGETGSGKTTQITQYLAECGFTNRGKIG
CTQPRRVAAMSVAKRVAEEFGCRLGQEVGYTIRFEDCTSPETVIKYMTDGMLLRECLIEA
DLKSYSVIMLDEAHERTIHTDVLFGLLKTAVQKRPELKLIVTSATLDAVKFSQYFFEAPI
FTIPGRTFPVEVLYTKEPETDYLDASLITVMQIHLREPPGDILLFLTGQEEIDTACEILY
ERMKSLGPDVPELIILPVYSALPSEMQTRIFDPAPPGSRKVVIATNIAETSLTIDGIFYV
VDPGFVKQKVYNSKTGMDSLVVTPISQAAAKQRAGRAGRTGPGKCYRLYTERAYRDEMLP
TPVPEIQRTNLATTVLQLKTMGINDLLHFDFMDAPPVESLVMALEQLHSLSALDDEGLLT
RLGRRMAEFPLEPNLSKMLIMSVALQCSDEILTIVSMLSVQNVFYRPKDKQALADQKKAK
FNQIEGDHLTLLAVYNSWKNNKFSNAWCYENFVQIRTLKRSQDVRKQLLGIMDRHKLDVV
SAGKNSVRIQKAICSGFFRNAAKKDPQEGYRTLVDSQVVYIHPSSALFNRQPEWVIYHEL
VQTTKEYMREVTTIDPKWLVEFAPSFFRFSDPTKLSKFKKNQRLEPLYNKYEEPNAWRIS
RVRRRRN
NT seq 3804 nt NT seq  +upstreamnt  +downstreamnt
atggatgaactgcaaaaattggagcatttatccctggtgtccaaactctgcaccgaattg
gacaaccatttgggtatcaacgacaaggatttggccgagtttataattgaattggaatcc
aagaatcccacgtttgagggatttcgaaaggcattggtggaaaatggagctgaattccca
gattcgttgatttccaatctccagagaatcatcaagttaatgaaaccgtcaggtggtgga
gcaaatggtgacaaatcggcagcagctggtggagcagacagctcaggcaacaaatcatcc
aaaaccgaacaactggctgtaatgtttcctggcttagcaatgcccaatgataaattcagt
aaagtcgatgaacctgaatcccattccgaaaatgacagtgatgctgatgaaaagaagacg
aagaagaaaaaggacatcataaagaaagttgaagaggaagatatgaaagctgtggatgat
gctatgttggaattggaagctttagctccaggatttgccagcaaagtagaaacaaaagat
attaaaaagaaagtggaaaaaagatcacgctctagatcgaggtctagagaaagacaccgt
gaccgtgataggaaaagagatcgaagccgtgaacgcacaaaagacctggatagttcaaga
agccaagataaagatcgccgtcatagggagcgtgaacgacgttcaaggtcaagatctcgt
catcgtggtgaacgcaaaagatctcgttcccgctccagggagaacagtagaagacatcga
cgctcaagatcacgttcacgtgatagaagacgacgttccagatctagatccaaggagaga
tcgcgccatcataggagatccaggtcgcgtgaaaacaaacgtgaaaagatgccaccacca
gcaccaatgccagatgatccagaaccgggtaaaatatacaccggtaaagtggcaaacatt
gtgccctttggctgctttgtccaactgtttggtttgaaaaaacgctgggagggtttggtg
cacatatcccagttgcgttccgagggtcgtgttacggatgttacagaggtggttaaccgc
aactccacggttaaggtaaaggttatgtcgatcacgggacaaaaggtgtccctgtctatg
aaagaagttgaccaagagacgggacaggacttaaatcccctatcacatgcccctccgccg
gaaaatgaacttaaagatcgcaatccagatcgtccgtttggtggtggtacatccctgctg
aatttgcaaggtggagccgacaatgatgaaagcgattcccggaaacgtgtaacacgtatc
tctagtcccgagcgatgggaaatcaaacaaatgataagctccggcgtgttggatcgcagt
gaactgcccgacttcgatgaggaaacgggtcttgtacacaaagatgaggatgatgaagaa
gatattgaaatagaaattgtcgaggaagaaccaccatttttggcaggtcatggtcgtgct
ctgcatgacctatcaccggtacgtattgtcaaaaatccagatggctctttggcccaagct
gccatgatgcaatctgccctctccaaggaacgtcgggagcagaaaatgttgcaacgtgaa
caagatatggatgcagttcccacgggactaagcaagaactggatagatcccttgccagat
gaggactcaagccgaacattggcggcaaatgtaaggggtatgggtgcagcacccatggag
gttcccgaatggaaaaaacacgttataggcggcaagaaatcctcgttcggcaagaaaacc
gacatgtcattggtggagcaaagaaaatccctgcccatttacaagctacgcgacgatttg
attaaggcggtgaccgataatcaaattttgattgtcattggtgaaacgggctctggcaaa
actactcaaatcacccagtacttggctgaatgtggttttacaaatcgtggaaaaattggt
tgtactcagccacgtcgtgtcgctgccatgtccgtggctaaacgtgtggccgaagagttt
ggttgtcgtctgggccaagaggtgggctataccattcgttttgaggattgtaccagtcct
gagactgtcattaaatacatgacagacggtatgttgctgcgtgaatgtctcattgaggcc
gacctgaaatcctactcggtcattatgttggacgaagctcatgaacgtaccatccacacc
gatgtactgtttggcctactgaagacggcggttcaaaaacgtcctgaactgaaattaatt
gtgacctcggccactttggatgctgtcaagttttctcagtatttctttgaggcaccaatc
tttacgataccaggtcgaactttccccgtggaggtgttgtacacaaaggaacccgaaact
gactatttggatgcttcattgatcaccgttatgcaaattcatttgagggaaccacctgga
gatattttgctgttcttgacgggtcaagaagaaatcgacaccgcctgtgagattctctat
gaacgtatgaaaagtttggggcctgatgtcccagaattgattatattgcccgtctactca
gccctgccatctgagatgcagacaaggatctttgaccctgccccgccgggtagccgtaag
gtggttattgccaccaatattgccgagacatcgctaaccatagatggtatcttttatgtg
gtggacccgggattcgtgaaacagaaagtttacaactccaaaacaggcatggattctttg
gtcgttacacccatatcacaggccgctgctaaacaacgtgccggacgcgctggtcgtact
gggcccggaaaatgctatcgtctctacacggaacgtgcctatcgcgatgaaatgctgccc
acccctgttcccgaaattcagcgtacaaatctggccacaacagtgctgcagttgaaaacc
atgggcattaacgatcttttgcatttcgattttatggatgctccacctgtcgaatctttg
gtaatggccctggaacagttgcactccctgtcggctttggatgatgaaggtctgctgaca
cgcctcggtcggcgcatggccgagttccccttggaacctaatctctcgaaaatgttaatt
atgtcggtggccctgcagtgttccgatgagattctgaccatcgtttccatgctcagcgta
caaaatgtcttctatcgccccaaggacaaacaggcattggccgatcaaaagaaagccaaa
ttcaatcagattgagggtgatcatttgaccctgctggctgtgtacaacagctggaaaaac
aataaattttccaatgcctggtgttatgagaatttcgtacaaattcgtacactcaaacgg
tcgcaggatgttcgcaaacaattgctgggcattatggatcgtcacaaattggatgtggtg
tcggctggcaagaattcggtgcgcatacaaaaagccatttgttcgggtttcttccgtaat
gccgcaaaaaaagatccccaagaaggttatcgcaccttggtcgattcccaggtggtttac
atccatccatccagtgccctctttaatcgtcaacccgaatgggttatataccatgaattg
gtacaaaccaccaaggaatatatgcgagaagttacgaccatagatccgaaatggttggtg
gaatttgccccgtcgttctttagattctcagatccaacgaaattaagtaaattcaaaaag
aatcaaagacttgagccgctatataacaaatatgaagagccgaatgcttggcgtatatct
cgtgtgcgaagaagaagaaattga

DBGET integrated database retrieval system