KEGG   Musca domestica (house fly): 101899463Help
Entry
101899463         CDS       T03448                                 

Definition
(RefSeq) pterin-4-alpha-carbinolamine dehydratase isoform X1
  KO
K01724  4a-hydroxytetrahydrobiopterin dehydratase [EC:4.2.1.96]
Organism
mde  Musca domestica (house fly)
Pathway
mde00790  Folate biosynthesis
mde01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mde00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    101899463
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mde04147]
    101899463
Enzymes [BR:mde01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.96  4a-hydroxytetrahydrobiopterin dehydratase
     101899463
Exosome [BR:mde04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   101899463
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pterin_4a
Motif
Other DBs
NCBI-GeneID: 101899463
NCBI-ProteinID: XP_005179320
UniProt: A0A1I8M385
Position
Unknown
AA seq 175 aa AA seqDB search
MLKIFQKLVHVPNVYSKSTNSCIKTQMRCITAIGNRNDSSISEPVEKRARLVATAINSTI
RYSTATTVPVQKKKKMAKLTEQERAEQLQPLLDAGWSMVNGRDAIYREYIFQDFNQSFRF
MTGVALLAEKMNHHPEWFNVYNKLQVTMSTHDVGGLSAKDIRMAKYMEEEFKRYA
NT seq 528 nt NT seq  +upstreamnt  +downstreamnt
atgttaaaaatattccaaaaacttgttcatgttccaaatgtttattcaaaatcgaccaat
tcctgtatcaaaacacaaatgagatgtataacagccattggtaacaggaatgacagcagt
atttcagagcccgtggagaagagagcaagacttgttgccacagcaatcaattcgacaata
agatacagtacagcaacaacagttcccgtacaaaagaagaaaaaaatggccaaacttacc
gaacaggaacgcgctgaacaattgcaacctcttttggatgccggttggtcgatggttaat
ggacgtgacgccatttatcgtgaatacatttttcaagatttcaatcaatcttttagattt
atgaccggtgttgctctcttggcagagaaaatgaatcatcatcccgaatggtttaatgtc
tataataagcttcaagttacaatgtcaacacatgatgtaggcggtttaagtgccaaggat
attcgtatggccaagtacatggaggaagaatttaaacgttatgcttga

DBGET integrated database retrieval system