KEGG   Musca domestica (house fly): 101901664Help
Entry
101901664         CDS       T03448                                 

Definition
(RefSeq) probable peroxisomal acyl-coenzyme A oxidase 1
  KO
K00232  acyl-CoA oxidase [EC:1.3.3.6]
Organism
mde  Musca domestica (house fly)
Pathway
mde00071  Fatty acid degradation
mde00410  beta-Alanine metabolism
mde00592  alpha-Linolenic acid metabolism
mde00640  Propanoate metabolism
mde01040  Biosynthesis of unsaturated fatty acids
mde01100  Metabolic pathways
mde01212  Fatty acid metabolism
mde04146  Peroxisome
Module
mde_M00013  Malonate semialdehyde pathway, propanoyl-CoA => acetyl-CoA
mde_M00087  beta-Oxidation
mde_M00861  beta-Oxidation, peroxisome, VLCFA
Brite
KEGG Orthology (KO) [BR:mde00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    101901664
  09103 Lipid metabolism
   00071 Fatty acid degradation
    101901664
   00592 alpha-Linolenic acid metabolism
    101901664
   01040 Biosynthesis of unsaturated fatty acids
    101901664
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    101901664
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    101901664
Enzymes [BR:mde01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.6  acyl-CoA oxidase
     101901664
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Acyl-CoA_ox_N Acyl-CoA_dh_M
Motif
Other DBs
NCBI-GeneID: 101901664
NCBI-ProteinID: XP_005175489
Position
Unknown
AA seq 345 aa AA seqDB search
MAPATAINPDLVQERKNATINSEEFAIWWAGGSNELYKKREMAKLFYEDPQFVDHQHIAN
MSHKELYEYTTEKAVRFLLKLREYLKKQQPEAAPLTPIEEMYELRALMGGPLGSGLFPAN
FPLRLHYSMFLPTLLRQASDEQCKLWLEKAWNFDGIIGTYAQTELGHGTYLRGLETRADY
DIEKQEFILNSPTLTSYKWWPGGLGLTVNMVVLMAQLYIKGRSYGFQPFLVRIRNEKTHE
PEPGVDVGDIGPRIGLNGVNNGYLGLKNVRIPLNQMLSRNNQVLPDGTFVKGPEPLLLYG
TMVYVRVMIVRDVSVNLLQAATIATRYSAVRRQGVEAGGQQETQI
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atggcccctgcaacagccattaatcccgacctagtacaagaacgtaaaaatgccacaata
aatagtgaagaatttgccatttggtgggccggaggcagcaatgaactctataagaagcga
gaaatggctaaactattttatgaagatccacaatttgtggatcaccaacacattgccaat
atgtcgcataaggagctttatgagtatacaacagaaaaagctgtacgctttctgctcaag
ctgagagagtacttgaaaaaacaacagccagaggcggctcccctaacacccattgaggaa
atgtatgaattgcgtgccctaatgggtggtccattgggttctggtctgttcccagccaac
tttcctctacgcctgcactattccatgtttctgccaacccttctaaggcaagccagcgat
gaacagtgtaaactgtggttagaaaaggcatggaattttgatggcattattggtacctat
gcccagactgaacttggccatggcacctatttgaggggtcttgagactagagccgattat
gatatagaaaagcaagaatttattctcaactcaccgacactcacctcatacaaatggtgg
ccggggggtttgggtttaacagtgaatatggtggtgctaatggctcagttgtatatcaag
ggacgttcatatggtttccaaccatttttggtacgtatacgaaatgaaaagacgcatgaa
cctgaaccaggagtggatgtaggtgatattggtccccgcattggtttgaatggtgtcaat
aacggttatttgggtttgaaaaatgtccgcataccgttaaatcaaatgttatcgcgcaac
aatcaagttttaccagatggtacatttgttaagggtcccgaaccactgttgctgtacgga
actatggtttatgtgcgtgttatgattgtacgtgatgtttctgtgaatcttttgcaggcc
gctacgattgcaacgagatactctgcagtgcgtcgtcaaggtgtcgaagctggcggccag
caggaaacacaaatt

DBGET integrated database retrieval system