KEGG   Methylobacterium extorquens DM4: METDI0516Help
Entry
METDI0516         CDS       T00947                                 

Gene name
rocF
Definition
(GenBank) arginase (arginine amidinase)
  KO
K01476  arginase [EC:3.5.3.1]
Organism
mdi  Methylobacterium extorquens DM4
Pathway
mdi00220  Arginine biosynthesis
mdi00330  Arginine and proline metabolism
mdi01100  Metabolic pathways
mdi01110  Biosynthesis of secondary metabolites
mdi01130  Biosynthesis of antibiotics
mdi01230  Biosynthesis of amino acids
Module
mdi_M00134  Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:mdi00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    METDI0516 (rocF)
   00330 Arginine and proline metabolism
    METDI0516 (rocF)
Enzymes [BR:mdi01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     METDI0516 (rocF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-ProteinID: CAX22174
UniProt: C7CAE9
Position
480393..481319
Genome map
AA seq 308 aa AA seqDB search
MPAPSTIDLIGAPIEIGTSEPGAVMGPAALRTAGLLRVLRDLGFTVRDQGDLAPDCTPGQ
RDLPAIRAWMTEISRAVETALDGGSLPLVAGGDHSLSLGSIDGALRHCGRTGRPVFVLWL
DAHADFNTLETSPSGNVHGMPLAALCGEPGFDDLFAGGERPLLDPRRIHLFGLRSIDAGE
RAIVTQRQVNVIDMRTIDEFGVVAPLRRILDRVAAANGHLHVSFDVDFLDPAIAPGVGTT
VPGGATFREAHLIMEMLCDSGLVGSLDVVELNPFLDERGRSARALVELVASLFGRRIIDR
PTEPPLEA
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgcccgcaccgtccacgatcgacctcatcggcgcaccgatcgagatcggaacgagcgag
cccggagccgtgatggggccggcggccctgcgcaccgccggattgctgcgggtgcttcgg
gatctgggcttcacggtccgcgaccagggtgacttggcccccgactgcacgccgggccag
cgcgatctcccggcgatccgtgcctggatgaccgagatctcgcgggcggtggaaacggcc
ctggacggcggaagcctgccgctcgtggcgggcggcgaccacagcctgtcgctcggctcg
atcgacggggcgctgcgccattgcggccgcaccgggcggccggtcttcgtgctgtggctc
gacgcccatgccgacttcaacaccctggagacatcgccctccggcaacgtccacggcatg
ccgctggccgccctgtgcggcgagcccggtttcgacgacctgttcgccggtggcgaacgc
ccgctcctcgatccgcggcgcatccacctgttcggcctgcgctcgatcgatgccggcgag
cgggccatcgtcacgcagcggcaggtgaacgtcatcgatatgcggaccatcgacgagttc
ggcgtggtcgcaccgctgcgccgcatcctcgaccgggtcgcggccgcgaacggccacttg
catgtcagcttcgacgtggatttcctcgaccccgccatcgcgccgggcgtcggcacgacg
gtgccgggcggggcaacgttccgcgaggcgcatctcatcatggagatgttgtgcgattca
gggctggtcggctccctcgacgtggtggagctgaaccccttcctcgacgagcgcgggcgc
agcgcccgggcactcgtcgagctggtggcgagcctgttcggccgtcgcatcatcgaccgg
ccgaccgagccgccgctggaggcgtga

DBGET integrated database retrieval system