KEGG   Methylobacterium extorquens DM4: METDI1067Help
Entry
METDI1067         CDS       T00947                                 

Gene name
cycA
Definition
(GenBank) Cytochrome c2 precursor
  KO
K08738  cytochrome c
Organism
mdi  Methylobacterium extorquens DM4
Pathway
mdi02020  Two-component system
Brite
KEGG Orthology (KO) [BR:mdi00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    METDI1067 (cycA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 Ish1
Motif
Other DBs
NCBI-ProteinID: CAX22686
UniProt: C7CDF8
Structure
PDB: 

Position
980220..980582
Genome map
AA seq 120 aa AA seqDB search
MRHLILGAALALLLPVAAHAEGDAAAGEKAFAPCKACHNFEKNGVGPTLKGVVGAKAGEG
ADGYAFSDALKKSGLTWDEANLKEWLADPKKKVPGTKMVFPGIKDPKKVDDIIAYLKTKS
NT seq 363 nt NT seq  +upstreamnt  +downstreamnt
atgcgtcatctcatcctcggcgccgccctcgcgctgctgctgcctgtcgccgcccatgcc
gagggcgatgccgccgccggcgagaaggcgttcgcgccctgcaaggcctgccacaatttc
gagaagaacggcgtcggcccgaccctgaagggtgtcgtcggcgcgaaggccggtgagggt
gccgacggctacgccttctccgacgcgctgaagaagtccggcctcacctgggacgaagcc
aacctcaaggagtggctcgccgacccgaagaagaaggtgcccggcaccaagatggtcttc
cccggcatcaaggacccgaagaaggtcgacgacatcatcgcctacctcaagacgaagtcc
tga

DBGET integrated database retrieval system