KEGG   Methylorubrum extorquens DM4: METDI3494Help
Entry
METDI3494         CDS       T00947                                 

Gene name
crtF
Definition
(GenBank) hydroxyneurosporene methyltransferase CrtF
  KO
K09846  demethylspheroidene O-methyltransferase [EC:2.1.1.210]
Organism
mdi  Methylorubrum extorquens DM4
Pathway
mdi00906  Carotenoid biosynthesis
mdi01100  Metabolic pathways
mdi01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mdi00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00906 Carotenoid biosynthesis
    METDI3494 (crtF)
Enzymes [BR:mdi01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.210  demethylspheroidene O-methyltransferase
     METDI3494 (crtF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_2 Dimerisation2 Methyltransf_23 Methyltransf_12 Methyltransf_25 MTS DprA_WH MarR_2 Methyltransf_24
Motif
Other DBs
NCBI-ProteinID: CAX25137
UniProt: C7C8J6
Position
3423018..3424163
Genome map
AA seq 381 aa AA seqDB search
MTEAGPAPEKRGGWRERWLAFRNRMVASPGFQRWAAGFPLTRRIARRNTRALFDLCAGFV
YAQVLFACVRLDLFTLLRDGPLAPDALARRLDLPADRALTLLKAAASLDLITRLPDGRFA
LADLGAALIGNPSVAAMIEHHAMLYADLADPVALLRGEAGPTRLGGYWPYAEAGEAAQLG
SDSVAAYSGLMAASQALIADDVLDALPLADRACLMDVGGGEGVFLAQAARRHPGLALRLL
DLPPVAERAGARLAAEGLGDRVTYFGRSFLGASLPEGADAITLVRVVHDHDDAVALALLR
AAHAALPPGGLLAIAEPMAGTPGAEPVGDAYFGIYLLAMGSGRPRTADELTAMLTQAGFR
EIRERPTRRPLLARLITAKRR
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaggccggacccgcgccggagaagcgcggcggctggcgcgagcgctggctcgcc
ttccgtaaccgcatggtcgccagccccggcttccagcgctgggcggcggggtttccgctg
acccgccggatcgcgcggcgtaacaccagggcgttgttcgatctctgcgccggcttcgtc
tacgcgcaggtgctgttcgcctgcgtccggctcgacctgttcacgctgctgcgggacggc
ccgctggcccccgatgctctggcccggcgtctcgatctgccggccgatcgcgccctgacc
ctgctcaaggccgccgcctcgctcgacctgatcacccggctgccggacgggcgcttcgcc
ctggccgatctcggcgcggcgctgatcggcaatccctcggtcgcggcgatgattgagcac
catgcgatgctctacgccgatctggccgatcccgtcgccctgttgcgcggagaagcgggg
ccgacacggctcggaggctactggccctatgccgaagccggcgaggcggcgcagctcggc
tcggattcggtcgcggcctatagcggcttgatggcggcctcgcaggctctgatcgccgac
gatgtgctcgacgccctgccgctcgctgatcgtgcgtgcctgatggatgtcgggggcggg
gagggcgtgttcctcgcgcaggccgcccgccgccatccggggctggccctgcgcctgctc
gatctcccgccggtcgcggaacgggcaggcgctcggctcgccgccgagggcctcggcgat
cgcgtcacctatttcggccgaagctttctcggtgcctccctgccggagggcgccgacgcg
atcaccctggtgcgggtcgtccacgatcacgacgacgcggtcgctctggcgctcctgcgc
gcggcccacgcggcgctgccgcccggcggccttctggcgatcgccgagccgatggccggc
acgcccggcgcggagccggtcggggacgcgtatttcggcatttatctcctcgccatgggc
agcggacggccccgcacggcggacgagttaaccgccatgctgacccaggccggcttccgt
gaaatccgcgaacgccccacgcggcgtccgctgctggcgcgattgatcaccgcaaagcgg
cgatag

DBGET integrated database retrieval system