KEGG   Methylorubrum extorquens DM4: METDI3829Help
Entry
METDI3829         CDS       T00947                                 

Definition
(GenBank) putative Glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
mdi  Methylorubrum extorquens DM4
Pathway
mdi00480  Glutathione metabolism
mdi00590  Arachidonic acid metabolism
mdi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mdi00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    METDI3829
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    METDI3829
Enzymes [BR:mdi01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     METDI3829
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA
Motif
Other DBs
NCBI-ProteinID: CAX25466
UniProt: C7CB54
Position
complement(3759523..3760017)
Genome map
AA seq 164 aa AA seqDB search
MSNLYDHVPRDARGGPHPLSQYRGKVLLVVNTASKCGFTPQYQGLETLWRRHRARGLVVL
GLPCNQFGAQEPGDAAAIEQFCSLTYDVTFPVLAKVEVNGPGADPLYVDLKREKPGLFGT
QAIKWNFTKFLIGRDGRVIGRFSPSTKPEALDGAIERALAEPGE
NT seq 495 nt NT seq  +upstreamnt  +downstreamnt
atgagcaacctctacgatcacgtcccacgcgacgcgcgcggcggaccgcatcccctgtcg
cagtatcgcggcaaggtgcttctggtggtcaacaccgcctcgaaatgcgggttcacgccg
caatatcagggcttggagaccctatggcggcgccatcgtgcccgcggcctcgtggtgctc
ggcctgccctgcaaccagttcggtgcacaggagccgggcgatgccgccgccatcgagcag
ttctgctcgctgacctacgacgtgacctttccggtcctcgccaaggtcgaggtcaacggc
ccgggcgccgacccgctctatgtcgatctcaagcgcgaaaagcccggcctgttcggcacg
caggccatcaagtggaatttcacgaaattcctgatcggccgggacggccgggtgatcggc
cgcttctccccatccacgaagcccgaggccctggacggtgcgatcgagcgggccctggcc
gagccgggcgagtag

DBGET integrated database retrieval system