KEGG   Methylorubrum extorquens DM4: METDI4034Help
Entry
METDI4034         CDS       T00947                                 

Definition
(GenBank) putative 3-ketoacyl-CoA thiolase (Fatty oxidation complex beta subunit) (Beta-ketothiolase) (Acetyl-CoA acyltransferase) (fadA-like)
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
mdi  Methylorubrum extorquens DM4
Pathway
mdi00071  Fatty acid degradation
mdi00072  Synthesis and degradation of ketone bodies
mdi00280  Valine, leucine and isoleucine degradation
mdi00310  Lysine degradation
mdi00362  Benzoate degradation
mdi00380  Tryptophan metabolism
mdi00620  Pyruvate metabolism
mdi00630  Glyoxylate and dicarboxylate metabolism
mdi00640  Propanoate metabolism
mdi00650  Butanoate metabolism
mdi00900  Terpenoid backbone biosynthesis
mdi01100  Metabolic pathways
mdi01110  Biosynthesis of secondary metabolites
mdi01120  Microbial metabolism in diverse environments
mdi01130  Biosynthesis of antibiotics
mdi01200  Carbon metabolism
mdi01212  Fatty acid metabolism
mdi02020  Two-component system
Brite
KEGG Orthology (KO) [BR:mdi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    METDI4034
   00630 Glyoxylate and dicarboxylate metabolism
    METDI4034
   00640 Propanoate metabolism
    METDI4034
   00650 Butanoate metabolism
    METDI4034
  09103 Lipid metabolism
   00071 Fatty acid degradation
    METDI4034
   00072 Synthesis and degradation of ketone bodies
    METDI4034
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    METDI4034
   00310 Lysine degradation
    METDI4034
   00380 Tryptophan metabolism
    METDI4034
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    METDI4034
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    METDI4034
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    METDI4034
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mdi04147]
    METDI4034
Enzymes [BR:mdi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     METDI4034
Exosome [BR:mdi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   METDI4034
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: CAX25669
UniProt: C7CCT9
Position
complement(3962826..3964034)
Genome map
AA seq 402 aa AA seqDB search
MPEAYIYDHVRTPRGRGKPDGSLHEVTALRLAETALRALKDRNGLDTRQVDDVVLGCVDP
VGEAGGDIARAAALVADYGTHVPGVQINRFCASGLDAINFAAAQVMAGQHDLTVGGGVES
MSRVGLGASGGAWPVDPAIAVKSYFMPQGVSADLIATKYGFSRDDCDAYAVESQKRSAQS
WGEGLFRNSVVPVRDINGITLLDRDEHMRPTTDMQSLASLKPSFVQMGQMGGFDAVAVDA
HPDVEAVHHVHHAGNSSGIVDGAAAVLIGSREAGDAAGLRPRARIRAFANIGSDPALMLT
GPVDVTKKVLARAGMSLSDIDLFEINEAFASVVLRFHQAFDLDPAKVNVNGGAIAMGHPL
GATGAMILGTVLDELERTGKERALVTLCIGAGMGTATIIERV
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgcccgaggcctacatctacgatcacgtccgcaccccccgcggtcgcggcaagccggac
ggttcgctgcacgaggtgacggcgttgcgcctcgccgagacggcgttgcgcgcgctcaag
gaccgcaacggcctcgacacgcggcaggtggacgacgtggtgctcggctgcgtcgatccg
gtcggcgaggccggcggcgacatcgcccgcgccgccgcgctcgtggccgattacggcacc
catgtgcccggcgtgcagattaaccgcttctgcgcctcgggcctcgatgccatcaacttc
gctgccgcgcaggtcatggccggccagcacgacctcaccgtcggcggcggcgtcgaatcg
atgagccgcgtcggcctcggcgcctcgggcggcgcctggccggtcgatccggcgatcgcg
gtcaaatcctacttcatgccgcagggcgtctcggccgacctcatcgccaccaagtacggg
ttcagccgcgacgattgcgacgcctacgccgtcgagtcgcagaagcgctcggcccaatcc
tggggcgagggcctgttccggaactccgtcgtgccggtgcgggacatcaacggcatcacc
ctgctcgaccgtgacgagcacatgcggccgacgaccgacatgcagtcgctggcgagcctg
aaaccgtccttcgtgcagatgggccagatgggcggcttcgacgccgtggccgtcgatgcc
cacccggatgtcgaggcggtccatcacgtccaccatgccggcaattcgtcgggcatcgtg
gacggcgcggcggcggtgctgattggctcgcgcgaggccggcgacgccgcgggcctgcgg
ccccgcgcccgcatccgggcgttcgccaatatcggctccgatccggcgctgatgctgacc
ggcccggtcgatgtcacgaagaaggtgctggcgcgggccggcatgagcctgtccgacatc
gacctgttcgagatcaacgaggccttcgcctcagtggtcctgcgcttccatcaggccttc
gacctcgacccagcgaaggtgaacgtcaacggcggcgccatcgccatgggccatccgctg
ggtgccacgggcgcgatgatcctcggcaccgtgctcgacgagctggagcgcaccggcaag
gagcgggcgctcgtcaccctgtgcatcggcgccggcatgggcaccgccacgatcatcgag
cgggtgtga

DBGET integrated database retrieval system