KEGG   Methylobacterium extorquens DM4: METDI4045Help
Entry
METDI4045         CDS       T00947                                 

Gene name
thrC
Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
mdi  Methylobacterium extorquens DM4
Pathway
mdi00260  Glycine, serine and threonine metabolism
mdi00750  Vitamin B6 metabolism
mdi01100  Metabolic pathways
mdi01110  Biosynthesis of secondary metabolites
mdi01120  Microbial metabolism in diverse environments
mdi01230  Biosynthesis of amino acids
Module
mdi_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:mdi00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    METDI4045 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    METDI4045 (thrC)
Enzymes [BR:mdi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     METDI4045 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thr_synth_N PALP Caud_tail_N
Motif
Other DBs
NCBI-ProteinID: CAX25679
UniProt: C7CCU9
Position
complement(3976099..3977511)
Genome map
AA seq 470 aa AA seqDB search
MLHVSTRGAAAPLSFSDALLAGLARDGGLYVPESWPQISRAEIAGFAGMRYAEVAKRVLR
PLIDGEIPDDALDEMIEAAYATFRHPAICPLTQIDDNLFLMELFHGPTLAFKDVAMQLLG
RLMDYVLRQKGGRATIVGATSGDTGSAAVEAFKGLDQVDVFILFPHGRVSEVQRRQMTTV
NAPNVHALAIDGNFDDCQNIVKAMFQHGDFADRVKLSGVNSINWARVAAQTVYYFTSAVA
LGAPHRKVSFAVPTGNFGDILAGWVAKRMGLPIERLMIGTNANDILARTLEHGAYEPRGV
QPTTSPSMDIQISSNFERLLFEALGRDASALGRLMAGLKQSGGFSLSPEVLGTVRNEFDA
TAVREPEVVEEIAGTFRKTGLVLDPHSAIGVRAGRRLLEKDPATPVVALATAHPAKFPDA
VSQATGGGRPVLPPHLAELMTRPETVANLANDQAAIERYITEHARITRGN
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
ttgctgcacgtctcgacccgcggcgccgctgcgcccttgagcttttccgatgcgctgctc
gccggcctcgcccgcgacggcggtctctacgtgcccgagagctggccgcagatcagccgt
gcggagatcgcgggctttgccggcatgcgctacgccgaggtcgccaagcgcgtgctgcgc
ccgctcatcgacggtgagattccggacgacgcgctcgacgagatgatcgaggcggcctac
gccaccttccgccatccggcgatctgcccgctcacccagatcgacgacaacctgttcctg
atggagctgtttcacgggccgacgctcgcgttcaaggacgtggcgatgcagctcctcggg
cggctgatggattacgtgctgcgccagaagggcggccgcgccaccatcgtcggcgccacc
tcgggcgatacgggcagtgccgcggtcgaggccttcaaggggctcgatcaggtcgacgtg
ttcatcctgtttccgcacggccgcgtctcggaggtgcagcgccggcagatgaccacggtc
aacgcgccgaacgtccacgcgctcgcgatcgacggcaatttcgacgattgccagaacatc
gtgaaggcgatgttccagcacggcgacttcgccgacagggtgaagctctcgggcgtcaac
tcgatcaattgggcgcgcgtcgccgcccagaccgtctattacttcacgagcgcggtggcc
ttgggcgccccgcaccggaaggtgtcgttcgcggtgccgaccggcaatttcggcgacatc
ctcgccggctgggttgccaagcggatgggcctgccgatcgagcggctgatgatcggcacc
aacgccaacgacatcctggcccgcaccctggagcacggggcctacgagccccgcggcgtg
cagccgacgacctcgccctcgatggacatccagatctcctcgaatttcgagcggctgctg
ttcgaggctttgggccgcgacgcctcggcgctcggccgcctgatggcgggtctgaagcag
tcgggcgggttttcgctgagccccgaggtgctgggcaccgtgcgcaacgagttcgacgcg
accgccgtgcgcgagcccgaggtcgtggaagagatcgcgggcaccttccgcaagaccggc
ctcgtgctcgatccgcacagcgccatcggcgtgcgcgccggtcgcaggctgctggagaag
gatccggccactccggtcgtggcgttggcgaccgcgcaccccgccaaattcccggatgcg
gtctcgcaggcgaccggcggcgggcgcccggttctgccgccccacctcgccgaactgatg
acccggcccgagacggtggcgaacctcgccaacgatcaggccgcgatcgagcgctacatc
acggaacacgcccgcatcacccggggcaactga

DBGET integrated database retrieval system