KEGG   Methylorubrum extorquens DM4: METDI4110Help
Entry
METDI4110         CDS       T00947                                 

Gene name
inh
Definition
(GenBank) isonitrile hydratase, ThiJ/PfpI family protein
  KO
K18199  cyclohexyl-isocyanide hydratase [EC:4.2.1.103]
Organism
mdi  Methylorubrum extorquens DM4
Pathway
mdi00930  Caprolactam degradation
Brite
KEGG Orthology (KO) [BR:mdi00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    METDI4110 (inh)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:mdi01002]
    METDI4110 (inh)
Enzymes [BR:mdi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.103  cyclohexyl-isocyanide hydratase
     METDI4110 (inh)
Peptidases [BR:mdi01002]
 Cysteine Peptidases
  Family C56: PfpI endopeptidase family
   METDI4110 (inh)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DJ-1_PfpI
Motif
Other DBs
NCBI-ProteinID: CAX25743
UniProt: C7CD13
Position
4045945..4046619
Genome map
AA seq 224 aa AA seqDB search
MTIEIGFLVFPKVQQLDLTGPYEVLAMVPGARVHLVAKALEPVTSATGLVLTPTITFAEC
PALDVICVPGGAGVNPLMEDAETLDFLRRQAERARYVTSVCTGALVLGAAGLLRGKRATT
HWAAHDLLAAFGAIPTEGRVVRDGNLITGGGVTAGIDFGLTLAAELTDVATAKAIQLHQE
YAPAPPFDAGRPETAGPEILAAARERLSVTRQERETIVARVTRG
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atgacaatcgagattggattcctcgtcttccccaaggtgcaacagctcgacctgaccggc
ccctacgaggtgctggccatggtgccgggcgcccgcgtccatcttgtcgcgaaggcgctg
gaaccggtcacgagcgccaccggcctcgtgctgacgcccacaatcaccttcgccgaatgc
ccggctctcgacgtgatctgcgtgcccggcggcgcgggggtgaacccgctgatggaggat
gccgagaccctcgacttcctgcgccgtcaggcggagcgcgcccgctatgtcacctccgtc
tgcaccggtgccctggtgctcggcgcggcgggacttctgcggggcaagcgggccaccacg
cactgggcggcgcacgatctcctcgccgccttcggggcgatcccgaccgaggggcgcgtg
gtgcgcgacggcaacctgatcaccggtggcggcgtgaccgcaggcatcgatttcggcctg
acgctcgcggccgaactcaccgacgtggcgaccgcgaaggcgatccagctccatcaggaa
tacgctccggccccgcccttcgatgccggccgccccgaaaccgcgggtccagagattctc
gcggccgcccgcgagcggctgtcggtgacgcgccaggagcgggagacgatcgtggcgcgg
gtgacgcggggttaa

DBGET integrated database retrieval system