KEGG   Methylorubrum extorquens DM4: METDI5177Help
Entry
METDI5177         CDS       T00947                                 

Definition
(GenBank) putative Acetyl-hydrolase
  KO
K14731  epsilon-lactone hydrolase [EC:3.1.1.83]
Organism
mdi  Methylorubrum extorquens DM4
Pathway
mdi00903  Limonene and pinene degradation
mdi00930  Caprolactam degradation
mdi01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:mdi00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    METDI5177
  09111 Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    METDI5177
Enzymes [BR:mdi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.83  monoterpene epsilon-lactone hydrolase
     METDI5177
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Abhydrolase_3 Hydrolase_4 Say1_Mug180 Peripla_BP_6 DLH
Motif
Other DBs
NCBI-ProteinID: CAX26790
UniProt: C7CKM0
Position
complement(5097911..5098831)
Genome map
AA seq 306 aa AA seqDB search
MTMASLRAHFYDLTIRLAVKGRLGGTHDVYAIRRAFEGARFPTPAGVAFTPGEVGGVPGE
WAEAAGADGERPTLLYCHGGGFIACSAQLYRPVTGRFARAGFRVFTPDYRLAPEHPFPAA
VEDCTGVWARLAEAGPAVVAGDSAGGSLALTTIIEARRLGLTPPVAAALFSPATDLIGRS
ASFRTNGRRDAMFRPEALMRLVPAYLAGADPADPRASPIEADFSGFPPLLIHVGVREILR
DDSLRLAEKAKAAGVPVELTVFPVVTHAWQLAESFLPEARRSLDEAATFLHRALKAPPHP
EAEVAA
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
gtgaccatggccagcctgcgcgcccatttctacgatctcaccatccgccttgcggtgaag
gggcggctcggcggcacccacgatgtctacgcgatccgccgcgccttcgagggcgcccgg
ttcccgacgccggccggcgtcgccttcacccccggcgaggtcggcggcgtgcccggcgag
tgggcggaggccgcaggggcggacggcgagcgccccaccctgctctactgccacggcggc
ggcttcattgcctgctcggcgcaattgtaccgcccggtcaccggccgcttcgctcgagcc
ggcttccgggtgttcacaccggattaccggttggcgccggagcaccccttccccgcggcg
gtcgaggattgcacgggcgtctgggccaggctcgcggaagcgggcccggcggtcgtcgcc
ggggattccgcgggcggcagcctggcgctcaccacgatcatcgaggcgcgccgcctcggc
ctgaccccgcccgtggcggcggccctgttctcgccggccaccgacctgatcggccgcagc
gcctcgttccgcacgaatgggcggcgcgacgcgatgttccgccccgaggcgctgatgcgg
ctggttccggcctacctcgccggggccgaccctgccgacccgcgcgcctcgccgatcgag
gcggatttttccgggtttccgccgctcctgatccatgtcggcgtccgcgagatcctgcgc
gacgattccctgcgcctcgccgagaaggccaaggccgcgggcgtgccggtcgaactcacg
gtgtttcccgtggtgacgcatgcttggcagctcgccgagagctttctgcccgaggcacgc
cgctccctcgacgaggccgcgaccttcctgcaccgcgccctgaaagcgcccccccatcct
gaggcggaggtcgccgcgtga

DBGET integrated database retrieval system