KEGG   Methylobacterium extorquens DM4: METDI5723Help
Entry
METDI5723         CDS       T00947                                 

Gene name
trpC
Definition
(GenBank) indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
mdi  Methylobacterium extorquens DM4
Pathway
mdi00400  Phenylalanine, tyrosine and tryptophan biosynthesis
mdi01100  Metabolic pathways
mdi01110  Biosynthesis of secondary metabolites
mdi01130  Biosynthesis of antibiotics
mdi01230  Biosynthesis of amino acids
Module
mdi_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:mdi00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    METDI5723 (trpC)
Enzymes [BR:mdi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     METDI5723 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS
Motif
Other DBs
NCBI-ProteinID: CAX27327
UniProt: C7C920
Position
5708866..5709723
Genome map
AA seq 285 aa AA seqDB search
MDDIVADVTVGPATSTPERASVLARIEAYKRREIAEAKLRLPLAKLEKQVAKADPPRGFA
DAIARHIAEGRPALIAEIKKASPSKGLIRADFDPETLAKAYAKGGATCLSVLTDTPSFQG
APDFLVEARAACDLPVLRKDFMFEPYQVYEARAWGADCILVIMACLDDAEAAAITETAHD
LGMDVLVEVHDAQELERALPLGTRLVGVNNRNLKTFEVSFETAITLKPGIPADRIAVAES
GIGGHADVLRLKQHGLNTVLVGESLMRQDDVTAATRALLFGEQGR
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atggacgacatcgtggccgacgtgaccgtcgggcctgccacctcgaccccggagcgggcg
agcgtgctggcccggatcgaggcctataagcgccgcgagatcgccgaggcgaagctgcgc
ctgccgctggccaagctggaaaagcaggtcgccaaggccgacccgccccgcggctttgcc
gacgccatcgcccggcatatcgcggaaggccgtccggccctgatcgccgagatcaagaag
gcctcgccctccaaggggctgatccgcgccgatttcgacccggagacgctggccaaggcc
tatgccaagggcggcgccacctgtctctcggtgctgaccgacacgccgtccttccagggc
gcaccggacttcctggtcgaggcgcgggcggcctgcgacctaccggtcctgcgaaaagac
ttcatgttcgagccgtatcaggtctacgaggcccgcgcctggggcgccgattgcatcctc
gtcatcatggcctgcctcgatgacgcggaggccgccgccatcaccgagaccgcgcacgat
ctcggcatggacgtgctggtcgaggtccacgacgcgcaggagctggagcgggccctgccc
ctcggcacgcgtctggtcggcgtcaacaaccgcaacctcaagaccttcgaggtctcgttc
gagaccgcgatcaccctgaagcccggcatccccgccgaccggatcgcggtggccgagagc
ggcatcggcggacatgccgacgtgctgcggctgaagcagcacgggctcaacaccgtcctc
gtcggcgagagcctgatgcggcaggacgacgtgaccgcggcgacgcgggccctgctgttc
ggagagcagggccggtga

DBGET integrated database retrieval system