KEGG   Microplitis demolitor: 103568193Help
Entry
103568193         CDS       T05600                                 

Definition
(RefSeq) UDP-glucuronic acid decarboxylase 1
  KO
K08678  UDP-glucuronate decarboxylase [EC:4.1.1.35]
Organism
mdl  Microplitis demolitor
Pathway
mdl00520  Amino sugar and nucleotide sugar metabolism
mdl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mdl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    103568193
Enzymes [BR:mdl01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.35  UDP-glucuronate decarboxylase
     103568193
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GDP_Man_Dehyd Epimerase 3Beta_HSD NAD_binding_4 RmlD_sub_bind Polysacc_synt_2 DUF4094 DUF241 DUF16 adh_short DUF1664 MtrG Tup_N
Motif
Other DBs
NCBI-GeneID: 103568193
NCBI-ProteinID: XP_008543160
Position
Unknown
AA seq 447 aa AA seqDB search
MVVNQRKLKQIGFVVFCILLGLGFYKGVSNIENGPSLAISKKLSLVSDRELDDKREINYQ
ENEVINSVNNNNDDLQEMKNRIHELEEKINQMESQIDNRVPKRFPSVKFLNYKNRRRILI
TGGAGFVGSHLVDRLMLEGHEVIVVDNFFTGRKRNVEHWVGHENFELVHHDIVRPVYLEV
DEIYHLASPASPPHYMHNPVKTLKTNTIGTINMLGLAKRVGAKVLIASTSEIYGDPMEHP
QSETYWGHVNPIGPRACYDEGKRVAETLSYAYMHQENIKVRVARIFNTYGPRMHMIDGRV
VSNFILQALQNDSITIYGNGEQTRSFQYVSDLVDGLVTLMASNYTQPINIGNPVEHTIEE
FAMIIKDLIGGTSKIIRLAAVEDDPQRRKPDISRAKKYLNWEPKVSLAEGLKKTIAYFVK
ELQRTKHLQKDMARVPFVNDHDIVDQL
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
atggttgtcaatcaacgaaaattgaaacaaattgggtttgttgtcttctgtatattatta
ggtttaggattttataaaggagtatccaacatagaaaatggaccatcgttggcgatttca
aaaaaactatcacttgtcagtgatcgtgagctagatgataaacgagaaataaattaccaa
gagaatgaagtaataaattctgtaaataacaataatgatgatctgcaagaaatgaaaaat
cgtatccacgaattggaagaaaaaataaatcaaatggaatctcagatagataatcgtgtg
ccgaagagatttcctagtgttaaatttttgaattataaaaatagaagacggatattaatt
actggaggtgctggctttgttgggtctcatttggttgatcggttgatgcttgaagggcac
gaagttattgttgtggataatttttttactggaagaaaacgcaacgtcgaacactgggtt
ggccatgagaatttcgaactggttcatcatgatattgttagaccagtttatcttgaagta
gatgagatttatcatcttgctagtcctgctagtccgcctcattatatgcataatcctgtt
aagactcttaaaactaataccatcggaactattaatatgctcggactggcaaaacgagtt
ggtgctaaagtattaattgcaagtacgtctgaaatatatggagacccgatggaacatccg
caatcagagacatattggggccatgtcaatccaattgggcctagagcttgttatgatgaa
ggaaaacgtgtagcagagacactgagttacgcttatatgcatcaagaaaatataaaagta
cgggtggcgcgaattttcaatacctacggaccgcgaatgcatatgattgacggcagagtt
gtgtcaaatttcatcctccaagcgctgcagaacgactcaataacgatttatggcaatgga
gaacagactagatcctttcaatatgtttcggatttagttgatggacttgtaactcttatg
gcatctaattacacccagccaataaatattggtaatcctgtagaacatactattgaagag
ttcgctatgattattaaagacttaatcgggggtacaagtaaaataataagacttgctgct
gtcgaagatgatcctcagcggcgcaaaccagatatatcacgtgctaaaaagtatcttaat
tgggagcctaaagtatcattggcagaagggctaaaaaagacaattgcatattttgttaaa
gaattacaaaggactaaacatttacaaaaagacatggcgcgtgttccatttgttaatgat
cacgatatagtcgatcagttataa

DBGET integrated database retrieval system