KEGG   Microplitis demolitor: 103568557Help
Entry
103568557         CDS       T05600                                 

Definition
(RefSeq) protein IWS1 homolog
  KO
K17498  transcription factor SPN1
Organism
mdl  Microplitis demolitor
Brite
KEGG Orthology (KO) [BR:mdl00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:mdl03021]
    103568557
Transcription machinery [BR:mdl03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Others
     103568557
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Med26
Motif
Other DBs
NCBI-GeneID: 103568557
NCBI-ProteinID: XP_008543698
Position
Unknown
AA seq 1027 aa AA seqDB search
MADRADDENGMEDKRNSVGISRKSRSRSGSRASGSISPDVMNKNPRSPRSGASSPNDRPS
SPASVRSPSPENGRRSSRSRSRSKSMSRSHSGSPNRAGSQSPSESRASRSRSRSRSSVDS
RAASKSPDAARKSMSRSRSRSAGTSPARSREASRSRSRSNSPRSVKSAGKSSKTGSRSPS
PAANKRSASRSRSNSPQGKSPTGSRHSSKSRSRSRSKSRSKSRSRSPRSKSKSPSRSRSR
SKSKSRSRSPSQDAYKNGAASPHSDRGSQDAEKSEKINKSQSPSPAAGDRAASVARSHSG
SRPASPATSQRHSRSRSRSVGSRAASRSRSRTPKSRSRSRSRASSRSRSGSRKSRSRSRS
GSRKSISPAASRKSRSRSRSRSRKSHSRSRSGSRKSGSPSATRKSRSRSRSGSRKSHSRS
RSGSRKSGSPSATRKSRSRSRSGSRKSRSRSRSGSRKSASPAASRKSRSRSRTGSRKSRS
RSRSGSRKSGSPSATRKSRSRSRSGSRKSRSRSRSGSRKSASPAASRKSRSRSRSGSRKS
RSRSGSRRSHSGSRSRSRSGSRKSRSRSGSRRSRSGSRSRSRSRSRSGSRRSASRSRSRS
RSKSRSRSRSRSGSRARSGSRSKSRSRSRSKSGSRKSRSRSRSKDSTGSHSAKRGRVLSD
SDADDDEQVQRSKRTKHQISDSENENEDEEKGDSAEKDKNQDELEEDANQEEGDLVDQDD
GADDDRIREEGASDDFMSDFDRMMARKKEEQSRRRKRKDIDIINDNDDIIAQLLQDMKSA
SEEDRKLNQLSKPATKKIAMLPKVLSQLKKHDLQLAFLEHNVLHILTDWLAPMPDRSLPS
LRIRESLLKLLWEFPRIDQSSLKSSGIGKAVMYLYKHPRETKENKERAGKIISEWARPIF
NLSADLKALSKEERMQRDMEQTPQKKRKTDESSSSQKSQDINKALKGEAKPLRPGEPGWI
GRARVPKPSNKDYVVRPDWKSDVDISRSTKKQMNRFERHMKNYMDSKKMKAARRAVDISI
EGRKMSL
NT seq 3084 nt NT seq  +upstreamnt  +downstreamnt
atggctgatcgtgcagatgatgaaaatggaatggaggataagcgtaattcggttgggatt
agcaggaaaagtagatcgagatcgggatcaagagcttctggatctattagtccagatgtg
atgaacaaaaatcctcgcagtcccaggtctggagcatcgtctcctaatgatcggccaagt
tctccggcgtcagttagatctccttcgccggagaatggcagacggtcgtctcggtcacga
tcacgatcaaagtctatgtcaagaagtcattcgggatcgccgaatcgggctgggtcgcag
tcaccgagtgaatctagagccagtagatcaagatcgaggtcaaggtcgtcagtagattca
cgagctgcgtcaaaatcacctgatgctgcaagaaaatcgatgtctagatcaagaagtcgg
tctgctggtacttctccagcgcgttcaagagaagcttcacgttcgcgttcacgttctaat
tctcctagaagtgttaaatctgctggtaaatcttccaagactggttctaggtcaccttca
cccgcggctaataaaagatcggcatctcgatcgagatcaaatagccctcaaggtaaatct
ccaactggttctcgtcattcgtcaaagtctagatcacgctcgaggtcaaaatccagatct
aaatcacgatcccgttctccaagatcaaagtcaaaatctccatctagatcacgctcaaga
tctaaatcaaagtcacgatctcgatctccatctcaggatgcttataaaaatggcgctgct
tcaccacattctgatagaggctcccaagatgctgaaaaaagcgaaaaaattaacaagtca
caatcaccttcgcccgctgcaggtgatcgagctgctagtgtagctagatcacattctgga
tcaagacccgcctctccagctacttctcagagacattcacgctcaagatcacgttcagtt
ggatcacgagctgcttcacgatcaagatcacgtactcccaaatcacgttccagatctcgc
tcgagagctagttcaagatcacgttcaggatctagaaaatctcgttcgagatcaaggtcg
ggatcgagaaaatctatttcaccagctgcttctagaaaatccagatctcggtcacgttca
agatctagaaaatctcattcaagatcaagatcaggatcaagaaaatccgggtcaccatcg
gctacgagaaaatcgagatctcgttccagatcaggatcaagaaaatcccactcaagatca
cgatccggatcgagaaaatccgggtcaccatcagctacgagaaaatcgagatctcgttca
agatcaggatcaagaaaatctcgctcaagatcaagatcgggatcaagaaaatctgcttct
ccagctgcttctagaaaatccagatcccgatcaaggacagggtcaagaaaatctcgctca
agatcacgatcgggatcgcgaaagtccgggtcaccatcagctacaagaaaatcgagatct
cgttccagatcaggatccagaaaatctcgctcgagatcaagatcggggtcaaggaaatct
gcttcgccagcagcttcaagaaaatcaagatcacgctcaagatctggatcacgtaaatca
cgttcacgttcaggctctcgtagatcacattcaggttctagatctcgttcgcgatcagga
tctagaaaatcacgttcaagatctggttccagaagatctcgctctggctctcgatcacgc
tctcgttcaagatcacgttcaggctcaagacgctcagcctcaagatcacgatcgagatca
agatccaaatcaagatctcgctcacgatcacgatccggctcaagagctagatctggctca
cgatcaaaatctcgttcacgttcacgttcaaaatccggatcaagaaaaagccgcagtcgt
agccgtagtaaagattcaactggttcccactcagcaaaacgtggtcgtgttctatcagac
tccgatgccgacgatgatgaacaagtccagcgatcaaaacgcacaaagcaccaaatatct
gattccgaaaatgaaaacgaggacgaggaaaaaggagactctgcagaaaaagataaaaat
caagatgaattggaagaagatgctaaccaagaagaaggagatctcgttgatcaagatgac
ggtgccgacgatgacagaattcgtgaagaaggagcatccgacgatttcatgtcagacttt
gatcgtatgatggcgcgtaaaaaagaggaacagtcacgacgacgtaagcgcaaagacatt
gacattattaatgacaacgatgacataatagcccaattattacaagacatgaaatcagcc
tcagaagaagacagaaaattaaatcaattatcaaaaccagcaaccaaaaaaatagccatg
ctccccaaagtgctttcccagctgaaaaaacatgatttgcaactggcattccttgagcac
aatgtattacacatattaactgactggcttgcacccatgcccgaccgttcattaccgtct
ctacgaattcgtgagagtttactgaaattattatgggagtttcctcgtattgatcaaagt
tcactaaagtcatctggtatcggtaaagctgttatgtatttatacaaacatcctagagaa
actaaagaaaataaagaacgagctggtaaaataataagcgaatgggccagaccaatattt
aatctttcagcagatcttaaagctctcagcaaagaggaacgtatgcagcgtgatatggaa
cagacaccacaaaagaaaaggaagaccgacgaaagtagttcatcacaaaaatcacaggat
atcaataaagcgctcaagggcgaggccaaacctctgagacctggcgaacctggatggatt
ggcagagctcgtgtacctaaaccttccaataaagattacgtcgtacgacctgactggaaa
tcagacgtcgatatcagtcggagtactaagaagcaaatgaaccgattcgaacgacacatg
aaaaattacatggacagcaaaaaaatgaaggctgctagacgtgcggttgatatttctatc
gaaggacgtaaaatgtcattataa

DBGET integrated database retrieval system