KEGG   Microplitis demolitor: 103569302Help
Entry
103569302         CDS       T05600                                 

Definition
(RefSeq) pseudouridine-5'-phosphatase isoform X1
  KO
K17623  pseudouridine 5'-phosphatase [EC:3.1.3.96]
Organism
mdl  Microplitis demolitor
Brite
KEGG Orthology (KO) [BR:mdl00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mdl01009]
    103569302
Enzymes [BR:mdl01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.96  pseudouridine 5'-phosphatase
     103569302
Protein phosphatases and associated proteins [BR:mdl01009]
 HAD phosphatases
  Other HAD phosphatases
   103569302
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HAD_2 Hydrolase Hydrolase_6 HAD Hydrolase_like TAF1D
Motif
Other DBs
NCBI-GeneID: 103569302
NCBI-ProteinID: XP_008544754
Position
Unknown
AA seq 233 aa AA seqDB search
MANEYKKVTHVLFDMDGLLIDTEYRYTEAFNNVLNKYGKTFTWEIKAMTMGFHMYESAKK
IVEMLEVPLSPEEFLEQLKPQYEKLFPNSKLMPGAERLLRHLHKHNIPIALATSSSESSY
ELKTKNLKPIFELFHHRVLGGSDPDVKKGKPAPDIFLVAASRFSDSDPVQPSQCLVFEDA
PNGVQAAVSAGMQVVMVPDENLPKELSEKATMVLHSLEEFKPELFGLPPFSED
NT seq 702 nt NT seq  +upstreamnt  +downstreamnt
atggctaacgagtataaaaaagtaactcatgttttatttgacatggacggtcttcttatt
gatactgagtatcgttacacagaggcatttaataacgtattaaataagtacggaaaaaca
ttcacgtgggagatcaaggccatgacgatggggttccacatgtacgagagtgcgaagaaa
atagtggagatgctcgaagtgccgctgtcacccgaagaatttttggagcagctgaagccg
caatatgaaaaattatttccaaacagcaaactgatgccaggagctgaacgactgttacga
catttgcataaacacaacattccgatcgcacttgctacgagttctagcgagagcagctac
gaactaaagacgaaaaatcttaagccgattttcgaacttttccatcaccgtgtcctgggc
ggctcggatcctgatgtaaaaaaaggaaaaccagccccggatatattccttgttgccgct
agcagattctctgactccgatcccgttcaaccctctcagtgtctagtctttgaagatgcg
ccgaatggcgtacaagcggccgtgagcgctggtatgcaagttgtgatggtaccagacgaa
aatctaccgaaggaactgagcgaaaaagctacgatggtgctacacagtctagaagaattt
aaaccggaattgtttggactgcctccgttctctgaggattag

DBGET integrated database retrieval system